Recombinant Bifidobacterium longum Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Bifidobacterium longum Protein CrcB homolog 1 (crcB1) is a protein homolog identified in Bifidobacterium longum . CrcB1 shares similarity with the CrcB protein of E. coli, which is involved in fluoride resistance . The CrcB1 protein, found in various bacterial species, is associated with resistance to fluoride and the transport of anions .

  • Basic Information :

    • Chemical Name: Recombinant Bifidobacterium longum Protein CrcB homolog 1 (crcB1)

    • CBNumber: CB715628995

    • Molecular Weight: 0

Function and Characteristics

CrcB1 proteins are integral in various biological processes, particularly in conferring resistance to fluoride in bacteria . Research indicates that CrcB1 homologs facilitate fluoride efflux, thereby reducing intracellular fluoride concentration and protecting cells from its toxic effects .

Role in Fluoride Resistance

  • Mechanism: CrcB1 proteins function as anion channels that mediate fluoride efflux . This reduces the accumulation of fluoride within the cell, mitigating its inhibitory effects on essential enzymatic processes .

  • Oral Streptococci: In oral streptococci, CrcB1 and EriC1 proteins play a crucial role in fluoride resistance . Studies have demonstrated that inactivation of CrcB1 homologs results in increased sensitivity to fluoride .

Research and Applications

AreaDescription
Antimicrobial ResistanceResearch explores the use of Bifidobacterium longum FB1-1, which produces substances that inhibit the spread of drug resistance in Klebsiella pneumoniae . Its cell-free supernatant (CFS) contains antibacterial activity and can reduce the expression of genes responsible for carbapenem resistance . This offers a novel approach to developing antibacterial drugs .
Coronavirus InhibitionThe cAMP-responsive element-binding protein (CREB1) interacts with the SARS-CoV-2 helicase non-structural protein 13 (nsp13), enhancing its activity . Inhibiting CREB1 impairs SARS-CoV-2 replication, suggesting that the PKA-CREB1 signaling axis could be a therapeutic target against coronavirus infection .
Heavy MetalsStudies reveal the presence of heavy metals like arsenic and lead in protein supplements, raising concerns about the safety and quality of these products .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request, but incurs additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Note: While the tag type is determined during production, we can prioritize the development of a specific tag if provided in advance.
Synonyms
crcB1; BL0547; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Bifidobacterium longum (strain NCC 2705)
Target Names
crcB1
Target Protein Sequence
MMWMICLFGGLGAMARYVLDVSIQRGWNRENRRTNRNFPLSTLVINGVASLCAGIAMMSY YSQSVDMDTVMMFVVGFLGGFSTFSTALNEVVSLIRQRRFTLALGYGIATVAVPLICVAA GFGIALLANPA
Uniprot No.

Target Background

Function
Plays a crucial role in reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links

KEGG: blo:BL0547

STRING: 206672.BL0547

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the significance of Bifidobacterium longum as a recombinant protein expression system?

Bifidobacterium longum represents a significant probiotic species with demonstrated anti-cancer and immunomodulatory properties. As a recombinant protein expression system, B. longum offers several advantages over conventional bacterial systems, particularly for therapeutic applications targeting the gastrointestinal tract.

The significance of B. longum stems from its natural colonization of the human gut, GRAS (Generally Recognized As Safe) status, and ability to survive the harsh gastrointestinal environment. Research has demonstrated that B. longum can modulate immune responses through interactions with natural killer (NK) cells and dendritic cells (DCs). For instance, Fink et al. (2007) showed that B. longum could initiate NK/DC interactions via DC maturation and enhance the catalytic potential of NK cells to produce interferon-γ (IFN-γ) . This immunomodulatory capacity makes B. longum an excellent candidate for delivering therapeutic proteins to target sites within the intestine.

For recombinant protein expression, researchers typically employ shuttle vectors containing Bifidobacterium-specific promoters and signal sequences to ensure efficient expression and, if desired, secretion of the target protein. When working with B. longum, researchers should consider strain-specific characteristics, as growth rates and transformation efficiencies can vary significantly among different strains.

How does CrcB homolog 1 (crcB1) function in bacterial systems?

CrcB homolog 1 (crcB1) belongs to a family of membrane proteins initially identified for their role in fluoride ion resistance in bacteria. In bacterial systems, CrcB proteins form fluoride ion channels that export toxic fluoride ions from the cell, protecting essential metabolic enzymes from inhibition.

Methodologically, researchers can assess CrcB1 function through several approaches:

  • Growth inhibition assays: Comparing growth curves of wild-type and crcB1-knockout strains in the presence of varying fluoride concentrations to establish the protective function of CrcB1.

  • Fluoride ion uptake measurements: Using fluoride-selective electrodes or fluorescent probes to quantify intracellular fluoride levels in strains expressing or lacking CrcB1.

  • Protein localization studies: Employing fluorescent protein fusions or immunolocalization techniques to confirm membrane localization of CrcB1.

  • Protein interaction analyses: Implementing pull-down assays, bacterial two-hybrid systems, or crosslinking experiments to identify proteins that interact with CrcB1.

Recent research suggests potential roles beyond fluoride resistance, including involvement in cellular stress responses and potential interactions with host immune systems, making CrcB1 an interesting target for recombinant expression in B. longum for research and potential therapeutic applications.

What are optimal experimental conditions for co-culture studies involving recombinant B. longum?

Based on experimental evidence, the following conditions have proven effective for co-culture studies involving B. longum with mammalian cells:

ParameterOptimal RangeConsiderations
B. longum concentration1×10^6 - 1×10^8 CFU/mLConcentrations >1×10^8 CFU/mL may affect cell viability
Co-culture duration8 hoursBalances interaction time with minimal impact on cell viability
Media conditionsAnaerobic to microaerophilicConsider using specialized co-culture media
pH6.5-7.2Monitor pH throughout experiment
Temperature37°CStandard for both mammalian cells and B. longum

Research by Frontiers in Microbiology demonstrated that when the co-culture time was set to 8 hours, the CCK-8 assay showed tumor cells could co-grow with B. longum without being affected by other factors when the B. longum concentration was between 1×10^6 CFU/ml and 1×10^8 CFU/ml . The results of colony formation assays indicated significant inhibition of long-term survival of cancer cell lines when B. longum count was greater than 1×10^7 CFU/ml .

For optimal results, researchers should validate these conditions with their specific cell lines and recombinant B. longum strains, as genetic modifications may alter bacterial growth characteristics and interactions with mammalian cells.

What experimental designs are most appropriate for studying the effects of recombinant B. longum expressing CrcB1?

The Completely Randomized Design (CRD) represents an excellent starting point for studying recombinant B. longum expressing CrcB1. CRD is a research methodology in which experimental units are randomly assigned to treatments without systematic bias . This approach is particularly valuable when working with biological systems where numerous uncontrolled variables may exist.

For studying recombinant B. longum expressing CrcB1, consider the following experimental design approaches:

  • Factorial Designs: Implement multi-factor experiments that simultaneously evaluate variables such as:

    • CrcB1 expression levels (controlled by different promoters)

    • Environmental conditions (pH, oxygen levels, nutrient availability)

    • Host cell types (if studying interactions with mammalian cells)

  • Dose-Response Studies: Establish concentration-dependent effects by varying:

    • Bacterial concentration (1×10^6 - 1×10^10 CFU/mL)

    • Exposure time (4, 8, 12, 24, 48 hours)

    • CrcB1 expression levels

  • In Vivo Models: For translational research, consider:

    • Gnotobiotic animal models with defined microbiota

    • Disease-specific models (e.g., inflammatory bowel disease, colorectal cancer models using AOM/DSS)

    • Tracking techniques for monitoring colonization and persistence

When designing these experiments, researchers should incorporate appropriate controls, including:

  • Wild-type B. longum (non-recombinant)

  • B. longum expressing non-functional CrcB1 mutants

  • B. longum expressing irrelevant proteins of similar size/properties

Statistical power calculations should be performed beforehand to determine appropriate sample sizes, as CRD may sometimes necessitate larger sample sizes to achieve meaningful results .

How can researchers analyze the anti-cancer effects of recombinant B. longum expressing CrcB1?

Based on established protocols for studying B. longum's anti-cancer properties, researchers can implement a comprehensive suite of assays to evaluate the potential anti-cancer effects of recombinant B. longum expressing CrcB1:

  • Proliferation Assays:

    • CCK-8 assay for short-term viability assessment

    • Colony formation assay for long-term survival evaluation

    • BrdU incorporation for DNA synthesis quantification

  • Migration and Invasion Analysis:

    • Wound-healing assay to assess migration capability

    • Transwell migration and invasion assays to evaluate both migration and invasive potential

  • Apoptosis Detection:

    • Annexin V/PI staining followed by flow cytometry

    • TUNEL assay for DNA fragmentation visualization

    • Caspase activation assays (caspase-3, -8, -9)

  • Molecular Pathway Analysis:

    • Western blotting for key signaling proteins

    • qRT-PCR for gene expression changes

    • Phospho-specific antibodies to track signaling activation

  • Immune Response Evaluation:

    • NK cell activation assays

    • Dendritic cell maturation analysis

    • Cytokine profiling (particularly IFN-γ, TNF-α, IL-10, IL-12)

Research has shown that B. longum can initiate NK/DC interactions and enhance IFN-γ production, contributing to tumor prevention . Additionally, B. longum has demonstrated significant inhibitory effects on proliferation, migration, and invasion of colorectal cancer cell lines such as LOVO, SW480, and SW1463 .

When analyzing results, researchers should incorporate time-dependent and dose-dependent analyses, as B. longum effects may vary significantly with concentration and exposure time. Statistical analysis should account for potential variability in biological responses using appropriate methods such as ANOVA with post-hoc tests.

What approaches are recommended for analyzing microbiome changes induced by recombinant B. longum?

Analyzing microbiome changes requires sophisticated methodological approaches to capture both taxonomic shifts and functional alterations. For recombinant B. longum studies, consider the following comprehensive strategy:

  • 16S rRNA Sequencing Analysis:

    • Target variable regions (typically V3-V4) for broad taxonomic profiling

    • Implement proper experimental controls (extraction blanks, mock communities)

    • Use multiple sequencing depths to ensure adequate coverage

  • Shotgun Metagenomic Sequencing:

    • Provides both taxonomic and functional insights

    • Allows detection of strain-level variations

    • Enables identification of horizontal gene transfer events

  • Metabolomic Analysis:

    • Short-chain fatty acid quantification (GC-MS)

    • Untargeted metabolomics (LC-MS/MS)

    • Bile acid profiling

  • Functional Assays:

    • Bacterial cultivation from samples to assess viable populations

    • Enzyme activity measurements (β-glucuronidase, bile salt hydrolase)

    • pH and redox potential measurements

Research has confirmed that B. longum can significantly impact gut microbiota composition, with effects on potentially beneficial bacteria such as Lactobacillus and other Bifidobacterium species . When studying recombinant B. longum expressing CrcB1, researchers should focus on potential changes in microbiome diversity, community structure, and functional pathways that might be indirectly affected by CrcB1 expression.

Data analysis should employ:

  • Alpha diversity metrics (Shannon, Simpson indices)

  • Beta diversity analyses (UniFrac, Bray-Curtis dissimilarity)

  • Differential abundance testing (DESeq2, ANCOM-BC)

  • Network analysis to identify key microbial interactions

How should researchers design and interpret co-culture experiments with recombinant B. longum and cancer cells?

Co-culture experiments represent a critical methodology for understanding direct interactions between recombinant B. longum and cancer cells. Based on established protocols, researchers should consider:

  • Experimental Design Considerations:

    ParameterRecommendationRationale
    B. longum concentrationTitration series (1×10^6 - 1×10^8 CFU/mL)Higher concentrations (>1×10^8) may cause non-specific effects
    Co-culture duration8 hours optimal, with 4-12 hour rangeBalances interaction time with cell viability
    Culture systemTranswell vs. direct contactDifferent systems reveal contact-dependent vs. secreted factor effects
    ControlsHeat-killed bacteria, filtered supernatantDistinguishes between live bacteria, bacterial components, and secreted factors
    Cell linesMultiple cancer cell lines (e.g., LOVO, SW480, SW1463)Accounts for cell-type specific responses
  • Analytical Approaches:

    • Short-term effects: CCK-8 assay, flow cytometry

    • Long-term effects: Colony formation assay

    • Migration/invasion: Wound-healing and Transwell assays

    • Molecular changes: RNA-seq, proteomics, phospho-proteomics

  • Interpretation Framework:

    • Distinguish direct (bacteria-cell contact) vs. indirect effects

    • Identify dose-response relationships

    • Consider temporal dynamics (immediate vs. delayed responses)

    • Compare effects across multiple cell lines to establish generalizability

Research has demonstrated that B. longum can significantly inhibit proliferation, migration, and invasion of colorectal cancer cells after 8 hours of co-culture . When the B. longum count was greater than 1×10^7 CFU/ml, long-term survival of cancer cell lines was significantly inhibited compared to control groups .

Importantly, researchers should verify that short-term survival of cancer cells is not affected by nutrient depletion or pH changes during co-culture, as these factors can confound interpretation of specific bacterial effects .

How can researchers effectively analyze transcriptomic data from experiments with recombinant B. longum?

Transcriptomic analysis of experiments involving recombinant B. longum requires specialized approaches to address the complexities of host-microbe interactions:

  • Experimental Design for Transcriptomics:

    • Include appropriate timepoints (early, intermediate, late responses)

    • Consider both bacterial and host transcriptomes

    • Include technical and biological replicates (minimum n=3)

  • Analysis Pipeline for Host Cell Transcriptomics:

    • Quality control (FastQC, MultiQC)

    • Read alignment (STAR, HISAT2)

    • Normalization (DESeq2, TMM)

    • Differential expression analysis (DESeq2, edgeR, limma)

  • Advanced Analytical Approaches:

    • Pathway analysis (GSEA, IPA, Reactome)

    • Protein-protein interaction networks

    • Transcription factor activity inference (SCENIC, DoRothEA)

    • Integration with ChIP-seq data when available

  • Bacterial Transcriptome Analysis:

    • Specialized bacterial RNA extraction protocols

    • rRNA depletion rather than poly-A selection

    • Mapping to appropriate reference genome

    • Operon-level analysis

Based on methodologies from CREB1 research, researchers can apply Rank-Rank Hypergeometric Overlap (RRHO) analysis to identify concordance between bacterial gene expression changes and host cell responses . This approach can reveal genes that are consistently altered by recombinant B. longum expressing CrcB1 across different experimental conditions or cell types.

For visualization and interpretation, researchers should present data in formats similar to those used in cancer research publications:

  • Heatmaps for differentially expressed genes

  • Volcano plots highlighting key genes

  • Pathway enrichment visualizations

  • Integrated multi-omic visualizations when available

What statistical approaches are recommended for analyzing CrcB1 effects in animal models?

When analyzing data from animal experiments involving recombinant B. longum expressing CrcB1, researchers should implement robust statistical approaches to account for the complexities of in vivo studies:

  • Power Analysis and Sample Size Determination:

    • Use preliminary data to estimate effect sizes

    • Account for anticipated attrition rates

    • Consider clustered or longitudinal study designs

  • Recommended Statistical Methods:

    • Linear mixed models for longitudinal data

    • Survival analysis for time-to-event outcomes

    • ANOVA with post-hoc tests for multiple group comparisons

    • Non-parametric tests when normality assumptions are violated

  • Advanced Statistical Considerations:

    • Account for cage effects using nested designs

    • Implement multiplicity corrections for multiple endpoints

    • Consider batch effects and covariates

    • Test for treatment-by-time interactions

  • Data Visualization:

    • Kaplan-Meier curves for survival analysis

    • Box plots with individual data points

    • Line graphs with error bars for longitudinal data

    • Forest plots for displaying multiple outcomes

For microbiome data from animal studies, specialized statistical approaches such as PERMANOVA for beta diversity, zero-inflated models for taxon abundance, and time-series analysis for longitudinal experiments should be considered to fully capture the dynamic changes induced by recombinant B. longum expressing CrcB1.

How can researchers address challenges in expression and stability of recombinant CrcB1 in B. longum?

Expressing recombinant proteins in B. longum presents several challenges, particularly for membrane proteins like CrcB1. The following methodological approaches can help overcome these limitations:

  • Codon Optimization Strategies:

    • Analyze codon usage in highly expressed B. longum genes

    • Optimize the CrcB1 coding sequence accordingly

    • Consider GC content and mRNA secondary structure

  • Expression Vector Optimization:

    • Test multiple promoters (constitutive vs. inducible)

    • Evaluate different signal sequences for optimal targeting

    • Consider fusion tags that enhance stability (His, FLAG, SUMO)

  • Culture Condition Optimization:

    • Evaluate growth temperature (30-37°C)

    • Optimize media composition (carbon sources, nitrogen)

    • Test anaerobic vs. microaerophilic conditions

  • Protein Stability Enhancement:

    • Implement site-directed mutagenesis to stabilize protein structure

    • Consider molecular chaperone co-expression

    • Test protease inhibitors or protease-deficient host strains

A systematic troubleshooting approach should include:

  • Western blotting with antibodies against CrcB1 or fusion tags

  • Functional assays to verify protein activity

  • Microscopy to confirm proper membrane localization

  • Proteomic analysis to identify potential degradation products

When stability issues persist, researchers might consider alternative approaches, such as using stronger promoters, integrating multiple copies of the gene, or employing protein engineering strategies to enhance the stability of the recombinant CrcB1 protein in the B. longum cellular environment.

What methods are recommended for verifying successful integration and expression of CrcB1 in B. longum?

Verifying successful integration and expression of CrcB1 in B. longum requires a multi-faceted approach:

  • Genomic Integration Verification:

    • PCR verification with primers flanking the integration site

    • Whole genome sequencing for definitive confirmation

    • Stability testing over multiple generations without selection

  • Transcriptional Analysis:

    • RT-PCR to confirm transcription

    • qRT-PCR for quantitative expression analysis

    • RNA-seq for genome-wide expression profiling

  • Protein Expression Verification:

    • Western blotting with anti-CrcB1 or anti-tag antibodies

    • Immunofluorescence microscopy for localization

    • Flow cytometry for population-level expression analysis

  • Functional Verification:

    • Fluoride resistance assays

    • Ion transport assays

    • Comparative phenotypic analysis

When analyzing expression levels in multiple clones, researchers should generate quantitative data that can be presented in table format:

Clone IDPCR VerificationmRNA Expression (Fold Change)Protein Expression (Western)Functional Activity
CrcB1-1Positive12.3 ± 1.5StrongHigh
CrcB1-2Positive8.7 ± 0.9ModerateModerate
CrcB1-3Positive15.1 ± 2.1StrongHigh
ControlNegative1.0 ± 0.1Not detectedNone

This comprehensive verification approach ensures that any observed phenotypes can be confidently attributed to the recombinant CrcB1 expression rather than to other genetic alterations or experimental artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.