Recombinant Bifidobacterium longum Protein CrcB homolog 3 (crcB3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
crcB3; BL1092; Putative fluoride ion transporter CrcB 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Bifidobacterium longum (strain NCC 2705)
Target Names
crcB3
Target Protein Sequence
MTVFLPILVCLCGGVGASCRYLLDVTIKTYWQRAFPLSTFTINLIAGFLAGLVAALALGG TLDEPWRLVLATGFLGGFSTFSTAINEMVTLFRKHRYPTAAAYLVLSLGVPVVAAACGFL V
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and mitigating its toxicity.
Database Links

KEGG: blo:BL1092

STRING: 206672.BL1092

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bifidobacterium longum Protein CrcB homolog 3 (crcB3)?

Recombinant Bifidobacterium longum Protein CrcB homolog 3 (crcB3) is a protein derived from the gut microbe Bifidobacterium longum, a gram-positive anaerobic bacterium found in the human gastrointestinal tract. CrcB proteins generally function as fluoride ion channels and contribute to resistance mechanisms in bacteria. In research contexts, this protein is produced through recombinant DNA technology to enable purification and controlled experimental study. B. longum has been associated with health benefits, including improved liver function in conditions such as biliary atresia, where its presence correlates with better outcomes following surgical intervention .

The recombinant version allows researchers to investigate specific properties and functions of the CrcB3 protein isolated from its native environment. Understanding the molecular characteristics of this protein provides insights into ion transport mechanisms and bacterial adaptation to environmental stresses, which may contribute to B. longum's beneficial effects in the human microbiome.

How does B. longum abundance relate to clinical outcomes in liver diseases?

B. longum abundance has demonstrated significant correlations with clinical outcomes in liver diseases, particularly biliary atresia (BA). Research shows that B. longum abundance is significantly lower in patients with BA before and after Kasai portoenterostomy (KPE) compared to healthy controls . This reduced abundance appears to have clinical significance, as B. longum levels are negatively correlated with gamma-glutamyltransferase levels after KPE (p<0.05) .

More importantly, patients with early detectable B. longum showed significantly lower total and direct bilirubin 3 months after KPE (p<0.005) and had a significantly lower liver transplantation rate (hazard ratio: 0.16, 95% CI 0.03-0.83, p=0.029) . These findings suggest that B. longum may play a protective role in liver function, potentially through mechanisms involving its constituent proteins, including CrcB homologs. Understanding these clinical correlations provides important context for researchers investigating specific B. longum proteins like CrcB3, as these proteins may contribute to the observed health effects through their biological functions.

What are the key considerations for designing experiments with Recombinant B. longum CrcB3?

When designing experiments with Recombinant B. longum CrcB3, researchers should adhere to fundamental experimental design principles while addressing the specific characteristics of this protein. According to established guidelines, four basic pillars should be considered: replication, randomization, blocking, and appropriate size of experimental units .

For protein-specific considerations:

  • Expression and purification optimization: Determine conditions that maximize protein yield while maintaining native conformation and activity.

  • Functional characterization assays: Design appropriate assays to measure specific activity of CrcB3, potentially focusing on ion channel functionality if aligned with known CrcB functions.

  • Control selection: Include negative controls (e.g., inactive protein variants) and positive controls (e.g., other CrcB homologs with known activity) to validate experimental findings.

  • Replication strategy: Ensure sufficient biological and technical replicates to account for inherent variability in protein behavior and experimental conditions.

Remember that experimental designs should be viewed as "a creative series of decisions that are meant to solve one or more problems" rather than following a rigid approach . For B. longum CrcB3 research, this might involve adapting standard protein characterization methods to address specific hypotheses regarding this protein's function in bacterial physiology or host-microbe interactions.

How should appropriate controls be selected when working with Recombinant B. longum CrcB3?

The selection of appropriate controls is crucial for validating experimental results when working with Recombinant B. longum CrcB3. Based on experimental design principles, consider the following control strategies:

  • Protein-specific controls:

    • Use heat-inactivated or denatured B. longum CrcB3 as a negative control to demonstrate activity-dependent effects

    • Include closely related CrcB homologs from other organisms (available from sources such as GeneBio Systems ) as comparative controls

    • Use wild-type B. longum lysate to compare recombinant protein behavior with native protein

  • Experimental controls:

    • Implement buffer-only controls to account for reagent effects

    • Use vehicle controls when using solvents or carriers

    • Apply blocking factors to control for known sources of variation

  • Biological context controls:

    • When studying B. longum CrcB3 in the context of health outcomes, include appropriate host factor controls as seen in studies of B. longum in liver disease

    • Consider temporal controls, especially when studying dynamic processes

How can researchers effectively compare B. longum CrcB3 function to other CrcB homologs?

Comparing the function of B. longum CrcB3 to other CrcB homologs requires sophisticated comparative analysis approaches. Based on the available data on various CrcB homologs , researchers should consider:

  • Sequence and structural comparison: Conduct detailed sequence alignments and structural predictions to identify conserved domains and unique features of B. longum CrcB3 compared to homologs from organisms like Rhodopseudomonas palustris, Flavobacterium psychrophilum, and Pyrococcus abyssi .

  • Functional assays: Develop standardized functional assays that can detect subtle differences in activity between CrcB homologs. For ion channel proteins, this might include:

Assay TypeMeasurementApplication to CrcB Homologs
Ion flux assaysDirect measurement of ion movementQuantitative comparison of transport efficiency
Patch-clamp electrophysiologySingle-channel conductanceDetailed kinetic analysis of channel properties
Fluorescence-based assaysIndirect measurement using ion-sensitive dyesHigh-throughput screening of conditions
Isothermal titration calorimetryBinding thermodynamicsComparison of ion binding affinities
  • Phylogenetic analysis: Place B. longum CrcB3 in evolutionary context through phylogenetic analysis of CrcB homologs across bacterial species to understand functional divergence and selective pressures.

  • Expression pattern comparison: Analyze the expression patterns of CrcB homologs under different environmental conditions to identify context-specific functions that may relate to bacterial adaptation.

This comparative approach yields insights into both conserved and unique aspects of B. longum CrcB3 function, potentially revealing species-specific adaptations in this protein family that contribute to B. longum's ecological niche in the gut microbiome.

What methodological approaches can resolve contradictory findings in CrcB protein research?

When faced with contradictory findings in CrcB protein research, researchers should implement a systematic approach to resolve discrepancies:

  • Standardization of experimental conditions: Develop consensus protocols for protein preparation, storage, and functional assays to eliminate technical variability as a source of contradictions.

  • Multi-laboratory validation: Establish collaborative networks to independently reproduce key findings using identical protocols, materials, and analytical methods.

  • Integrated data analysis: Apply meta-analysis techniques to aggregate data across studies, identifying consistent trends and outliers that may explain contradictions.

  • Investigation of biological variables: Systematically examine factors such as:

    • Strain-specific variations in CrcB proteins

    • Post-translational modifications affecting function

    • Environmental conditions altering protein behavior

    • Interaction partners modulating activity

  • Method triangulation: Apply multiple orthogonal techniques to investigate the same question, as recommended in qualitative research guidelines . This strategy helps identify method-dependent biases that may contribute to contradictory results.

Researchers should report their approach to resolving contradictions using clear documentation of methods, decision trees for data reconciliation, and transparent discussion of limitations, following reporting guidelines similar to those outlined in COREQ .

How can qualitative research methods enhance understanding of B. longum CrcB3 function?

Qualitative research approaches can provide valuable insights into the broader biological context of B. longum CrcB3. Following COREQ guidelines , researchers should consider:

  • Study design considerations:

    • Define a clear methodological orientation (e.g., grounded theory, phenomenology) that guides the investigation

    • Implement purposive sampling to identify key informants or literature sources

    • Provide detailed description of the research context and rationale

  • Data collection methods:

    • Develop comprehensive interview guides when consulting domain experts about CrcB3 function

    • Use audio/visual recording of laboratory observations to capture nuanced phenomena

    • Maintain detailed field notes during experimental work

    • Continue data collection until saturation is reached

  • Analysis approaches:

    • Employ multiple data coders to ensure reliability

    • Develop a systematic coding tree for analysis

    • Use appropriate software for qualitative data management

    • Validate findings through expert consultation

Qualitative approaches are particularly valuable for generating new hypotheses about CrcB3 function, identifying unexpected patterns in experimental results, and contextualizing molecular findings within broader biological systems. For example, observational studies of B. longum behavior under varying conditions might reveal patterns that inform subsequent mechanistic studies of CrcB3.

What reporting guidelines should researchers follow when publishing B. longum CrcB3 studies?

Comprehensive reporting of CrcB3 research findings is essential for reproducibility and knowledge advancement. Based on established reporting guidelines , researchers should:

  • Methods reporting:

    • Provide detailed protocols for protein expression, purification, and characterization

    • Clearly describe experimental design including replication strategy, randomization methods, and blocking factors

    • Specify all buffer compositions, incubation conditions, and equipment parameters

    • Report any deviations from pre-registered protocols or standard methods

  • Results presentation:

    • Include representative images of protein gels, activity assays, or other primary data

    • Present data in appropriate tables and figures with clear legends

    • Report both positive and negative findings

    • Include statistical analyses with appropriate effect sizes and confidence intervals

  • Qualitative component reporting:

    • Describe researcher characteristics and relationship with subjects when applicable

    • Detail participant selection methods and non-participation reasons

    • Specify data collection settings and conditions

    • Document the presence of non-participants during data collection

When reporting relationships between CrcB3 and biological outcomes, researchers should include precise statistical data, such as: "The abundance of B. longum was negatively correlated with gamma-glutamyltransferase levels after KPE (p<0.05)" , to enable proper interpretation and meta-analysis of findings.

What statistical approaches are most appropriate for analyzing CrcB3 functional data?

The analysis of CrcB3 functional data requires statistical approaches that account for the unique characteristics of protein functional studies:

  • For kinetic data analysis:

    • Nonlinear regression models for enzyme/channel kinetics

    • Time series analysis for dynamic functional measurements

    • Mixed-effects models to account for batch-to-batch protein variation

  • For comparative studies:

    • ANOVA with appropriate post-hoc tests for multi-group comparisons

    • Linear discriminant analysis for identifying distinguishing features between CrcB homologs

    • Random forest classification, which has been successfully applied in microbiome studies involving B. longum

  • For structure-function relationships:

    • Principal component analysis to identify key structural determinants of function

    • Hierarchical clustering to group functionally similar protein variants

    • Machine learning approaches to predict functional outcomes from structural parameters

When applying these methods, researchers should consider experimental design elements such as blocking factors and ensure proper validation through techniques like cross-validation or bootstrapping. The statistical approach should be determined during experimental planning rather than post-hoc, to ensure appropriate data collection and sample sizing.

How can researchers integrate CrcB3 findings with broader B. longum functional studies?

Integrating CrcB3-specific findings with broader B. longum functional studies requires a systematic approach to data synthesis:

  • Multi-omics integration strategies:

    • Correlate CrcB3 expression/activity with transcriptomic profiles

    • Map CrcB3 function to metabolomic changes in B. longum under various conditions

    • Relate protein-level findings to whole-organism phenotypes

  • Contextual analysis frameworks:

    • Consider CrcB3 function within the known ecological context of B. longum in the gut microbiome

    • Relate CrcB3 activity to observed health associations, such as improved liver outcomes

    • Examine CrcB3 regulation in response to environmental signals relevant to the gut environment

  • Translational research approaches:

    • Develop hypotheses about how CrcB3 function may contribute to clinical observations

    • Design targeted interventions based on CrcB3 mechanistic insights

    • Create predictive models that incorporate CrcB3 activity as a factor in B. longum ecological success

This integration should be guided by a systems biology perspective, recognizing that protein-level mechanisms contribute to organism-level functions, which in turn influence host-microbe interactions. Researchers should explicitly link their molecular findings to the established biological significance of B. longum, such as its negative correlation with gamma-glutamyltransferase levels and association with reduced liver transplantation rates in biliary atresia patients .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.