Recombinant Bifidobacterium longum subsp. infantis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

Recombinant Bifidobacterium longum subsp. infantis Prolipoprotein diacylglyceryl transferase (lgt) is a bacterial enzyme responsible for lipidating prolipoproteins, a critical step in the maturation of bacterial membrane proteins. This post-translational modification involves transferring a diacylglyceryl group to the sulfhydryl group of a conserved cysteine residue in prolipoproteins, anchoring them to the cell membrane . The enzyme is encoded by the lgt gene (Blon_1369 in strain ATCC 15697) and plays a role in cell envelope biogenesis, virulence, and host-microbe interactions .

Biological Context in B. infantis

B. longum subsp. infantis ATCC 15697 is a keystone gut symbiont in breastfed infants, specializing in human milk oligosaccharide (HMO) metabolism . While the lgt enzyme itself is not directly linked to HMO utilization, its role in membrane protein maturation supports:

  • Oligosaccharide Transport: Membrane-bound solute-binding proteins (SBPs) critical for HMO uptake require proper lipidation for functionality .

  • Host Interaction: Lipoproteins contribute to bacterial adhesion and immune modulation, which are essential for colonization .

Current Uses

  • Research Tool: Recombinant lgt is used to study lipoprotein processing in Bifidobacterium and other Gram-positive bacteria .

  • Structure-Function Studies: Investigating how lipid modification affects membrane protein localization and stability .

Key Research Findings

Study FocusOutcomeSource
Genomic Conservationlgt homologs are conserved across B. longum and B. infantis strains
HMO UtilizationIndirect link via maturation of HMO transporters (e.g., ABC transporters)
Immune ModulationLipoproteins may influence Th1/Th2 balance in infant gut immunity

Research Gaps and Future Directions

  • Mechanistic Studies: Limited data exist on substrate specificity or regulatory interactions in B. infantis.

  • Therapeutic Potential: No direct evidence links lgt to probiotic efficacy, though strain-specific genomic clusters (e.g., HMO utilization) suggest synergies .

  • Structural Biology: High-resolution crystal structures of lgt remain unpublished.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
lgt; Blon_1369; BLIJ_1413; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Target Names
lgt
Target Protein Sequence
MNLAYIPSPTFSKFEIGPFTIHMYAICILIGICVAVWILTTRWKRYGGTFDQILDTTLVT VPCALVGARLYHCITTPADYFPPTGNLVNILKVWEGGMAIFGGISVGTLVAFLWCRHKHY PFAIFADAIAPALPVAQAIGRLGNWFNQELYGWPTTLPWGLKLNDADAIGKSEICYSGAQ CPDYRTTLFHPTFLYEMIWNLIGAALIIYLGHKLADRLKAGQQFAMYLMWYGLGRTWIEN VRINYSTVILGLRTNMWTAIIVFVLGCILFVVLYQYGPDPKAQARGLAAVTADELERQSI EEERLRQKKQAKRTK
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from *Bifidobacterium longum* subsp. *infantis* catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.