Recombinant Bifidobacterium longum subsp. infantis Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

Undecaprenyl-diphosphatase (uppP) is a bacterial enzyme critical for cell wall biosynthesis, catalyzing the hydrolysis of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP). This reaction regenerates the lipid carrier required for peptidoglycan and teichoic acid synthesis, essential for bacterial cell wall integrity . Recombinant versions of this enzyme, such as those derived from Bifidobacterium longum subsp. infantis, are engineered for research and industrial applications, enabling studies on bifidobacterial physiology and host-microbe interactions.

Expression Systems and Optimization

Recombinant uppP can be produced in multiple hosts, each offering distinct advantages:

Host SystemYieldPosttranslational ModificationsTurnaround Time
E. coliHighLimitedShort
YeastModerateGlycosylationModerate
Insect CellsLowComplex modifications (e.g., phosphorylation)Long

E. coli remains the preferred host for high-throughput applications due to cost-effectiveness and rapid production .

Probiotic Development

  • Gut Colonization: uppP-mediated cell wall synthesis may enhance B. infantis resilience against bile salts and low pH during gastrointestinal transit, a trait critical for probiotic efficacy .

  • Immune Modulation: EPS produced by B. infantis (dependent on cell wall integrity) enhances macrophage activity and lymphocyte proliferation, suggesting uppP’s indirect role in immunomodulation .

Antimicrobial Research

  • Drug Target Potential: Inhibiting uppP could disrupt cell wall synthesis in pathogenic bacteria, though this remains unexplored in bifidobacteria .

Challenges and Future Directions

  • Functional Studies: No direct biochemical characterization of B. infantis uppP exists. Current data rely on homology with other bacterial systems .

  • Host-Specific Expression: Optimizing eukaryotic expression systems (e.g., yeast) could improve enzyme stability for industrial applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have specific requirements for the format, please indicate them in your order notes. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know. We will prioritize development of the specified tag if possible.
Synonyms
uppP; Blon_1151; BLIJ_1178; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-294
Protein Length
full length protein
Species
Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Target Names
uppP
Target Protein Sequence
MNFFQAIILGIVQALTEYLPVSSSAHIRIFGDLMLGSDPGAAFTAIIQIGTELAVILYFR HDIINILTHWFGCLFGRNGKDWKARMGRGDEYATLGWNIIVGSIPIVILGFTLQDVIETS LRNLWITVTVLLVFGVLLWVVDAKARQNKTMDDMTYRDAFLFGLGQSMALIPGVSRSGGT ITVGRALGYTREAAVRLSFLMAIPAVFGSGLLETVKAVKNYKTDAMFPGWGPTLVAMVIS FVLGYIVIIGFLKFVSTFSYKAFAIYRIGLAVVVALLLIVGVLPAIDPSVAAAA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its role in Bifidobacterium longum?

Undecaprenyl-diphosphatase (uppP), also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase (EC 3.6.1.27), is an integral membrane protein critical for bacterial cell wall synthesis. It catalyzes the dephosphorylation of undecaprenyl pyrophosphate, which is essential for peptidoglycan biosynthesis . In Bifidobacterium longum, this enzyme contributes to cell wall integrity and potentially influences the bacterium's remarkable ability to colonize the human gut. The gene is sometimes referred to as bacA or upk in genomic databases, with the ordered locus name BL0721 in B. longum strain NCC 2705 .

How does the structure of Bifidobacterium longum uppP differ from other bacterial undecaprenyl-diphosphatases?

Bifidobacterium longum uppP contains distinctive structural motifs that differentiate it from other bacterial homologs. The enzyme's active site consists of two critical consensus regions: the (E/Q)XXXE motif and the PGXSRSXXT motif, along with a conserved histidine residue . These regions are positioned near the aqueous interface of the protein and face the periplasm, suggesting that the enzyme's catalytic function occurs on the outer side of the plasma membrane. This topological orientation is significant for understanding substrate access and reaction mechanisms.

Comparative analysis shows that while these motifs are conserved across many bacterial species, the specific amino acid sequence in B. longum has adaptations that may reflect its evolutionary niche in the human gut.

What are the expression characteristics of the uppP gene in Bifidobacterium longum during colonization of the human gut?

Bifidobacterium longum is recognized as an exceptional colonizer of the human intestinal tract, persisting for extended periods compared to other probiotic strains. Unlike strains such as Lactiplantibacillus plantarum and Bifidobacterium animalis ssp. lactis that typically diminish within a week after administration, B. longum can persist for months . This colonization success is partially attributed to the expression of specific proteins including uppP.

The expression of uppP is likely upregulated during gut colonization as part of the bacterial response to membrane stress and as a mechanism for bacitracin resistance. The enzyme's activity may be particularly important during the establishment phase of colonization when the bacterium faces competition and host defense mechanisms.

What are the most effective methods for recombinant expression and purification of Bifidobacterium longum uppP?

Recombinant expression of Bifidobacterium longum uppP presents challenges due to its integral membrane nature. Based on established protocols for similar proteins, the following methodology is recommended:

  • Vector Selection: Use expression vectors with strong promoters (e.g., T7) and appropriate fusion tags to facilitate purification and enhance solubility. A bacteriorhodopsin fusion tag approach has proven effective for expression of other uppP proteins .

  • Host Strain: Transform the construct into E. coli C41(DE3), which is engineered for membrane protein expression.

  • Culture Conditions:

    • Grow transformed cells at 37°C in LB medium with appropriate antibiotics

    • Induce at OD600 ~0.9 with 0.5 mM IPTG

    • Add all-trans-retinal if using the bacteriorhodopsin fusion approach

    • Continue induction for 5 hours at 37°C

  • Membrane Fraction Isolation:

    • Disrupt cells using mechanical methods such as Constant Cell Disruption Systems

    • Collect membranes by ultracentrifugation at 40,000 rpm for 1.5 hours

  • Solubilization and Purification:

    • Solubilize membrane proteins using detergents like n-dodecyl-β-D-maltopyranoside (DDM) at 0.02%

    • Purify using affinity chromatography based on the fusion tag employed

    • Perform size exclusion chromatography for final purification

This methodology typically yields 1-5 mg of pure protein per liter of bacterial culture, suitable for subsequent enzymatic and structural studies.

What are the optimal conditions for assaying Bifidobacterium longum uppP enzymatic activity?

The enzymatic activity of Bifidobacterium longum uppP can be measured through phosphate release assays. Based on protocols developed for E. coli UppP, the following conditions are recommended:

  • Reaction Buffer: 50 mM HEPES, pH 7.0, 150 mM NaCl, 10 mM MgCl₂, 0.02% DDM

  • Substrate: Farnesyl pyrophosphate (Fpp) can be used as a substrate analog for kinetic studies, with concentrations ranging from 0.3-57 μM for Michaelis-Menten analysis

  • Enzyme Concentration: 20-40 nM purified uppP

  • Detection Method: Malachite Green reagent for quantification of released phosphate

  • Incubation: 37°C for the reaction period

  • Measurement: Absorbance at 650 nm, with quantification based on a phosphate standard curve

It's critical to note that uppP absolutely requires divalent cations (magnesium or calcium) for activity . The pH optimum is typically around 7.0, but activity should be tested across a range (pH 5-9) to determine the exact optimum for the B. longum enzyme.

How can site-directed mutagenesis be effectively utilized to investigate the structure-function relationship of Bifidobacterium longum uppP?

Site-directed mutagenesis is a powerful approach for elucidating the catalytic mechanism and structural requirements of uppP. Based on studies with homologous enzymes, the following strategy is recommended:

This methodical approach can provide comprehensive insights into which residues are essential for catalysis versus substrate binding or structural integrity.

How can molecular dynamics simulations enhance our understanding of Bifidobacterium longum uppP interactions with membrane lipids?

Molecular dynamics (MD) simulations offer valuable insights into the behavior of membrane proteins like uppP within lipid bilayers. For B. longum uppP research, the following approach is recommended:

  • Model Construction:

    • Generate a homology model based on known structures of related proteins

    • Employ Rosetta membrane ab initio modeling to refine the structure

    • Embed the protein in a lipid bilayer that mimics the B. longum membrane composition

  • Simulation Parameters:

    • Run simulations for at least 100 ns to observe stable protein-lipid interactions

    • Use the CHARMM36 force field for accurate membrane protein simulations

    • Implement periodic boundary conditions with NPT ensemble at 310K

  • Analysis Focuses:

    • Monitor the dynamics of the (E/Q)XXXE and PGXSRSXXT motifs

    • Track the accessibility of the active site from both periplasmic and cytoplasmic faces

    • Examine how substrate (undecaprenyl pyrophosphate) approaches and binds to the active site

    • Evaluate the role of divalent cations in the catalytic mechanism

  • Validation Experiments:

    • Design mutagenesis experiments based on simulation predictions

    • Use EPR or fluorescence spectroscopy to verify predicted protein dynamics

These simulations can reveal how the enzyme accommodates its lipophilic substrate while maintaining an active site accessible to water for hydrolysis, providing insights not readily available through experimental methods alone.

What approaches can be used to investigate the role of Bifidobacterium longum uppP in antibiotic resistance?

Undecaprenyl-diphosphatase is known to confer resistance to bacitracin in various bacteria. To investigate this function in B. longum, consider the following methodological approaches:

  • Gene Expression Analysis:

    • Quantify uppP expression using RT-qPCR when B. longum is exposed to different antibiotics

    • Use RNA-Seq to identify co-regulated genes in the presence of bacitracin

  • Gene Knockout/Knockdown Studies:

    • Create uppP knockout mutants using CRISPR-Cas9 or traditional homologous recombination

    • Alternatively, develop antisense RNA systems to downregulate uppP expression

    • Compare antibiotic susceptibility profiles of wild-type and modified strains

  • Complementation Assays:

    • Express B. longum uppP in antibiotic-sensitive bacteria (e.g., specific E. coli strains)

    • Test whether the introduced gene confers resistance

  • Biochemical Characterization:

    • Assess how bacitracin affects the enzymatic activity of purified uppP

    • Investigate direct binding between bacitracin and uppP using isothermal titration calorimetry

  • In vivo Competition Assays:

    • Co-culture wild-type and uppP-deficient strains in the presence of sub-inhibitory antibiotic concentrations

    • Monitor population dynamics using strain-specific markers

How does the exopolysaccharide production in Bifidobacterium longum interact with uppP function, and what methodologies can explore this relationship?

Bifidobacterium longum produces exopolysaccharides (EPS) that shield the bacterium from harsh environmental conditions like acidity and bile salts . The potential relationship between EPS production and uppP function warrants investigation using these approaches:

  • Comparative Transcriptomics:

    • Analyze gene expression correlation between uppP and EPS biosynthesis genes under various conditions

    • Identify potential co-regulation or oppositely regulated patterns

  • Cell Wall Analysis:

    • Compare cell wall composition in wild-type, uppP-overexpressing, and uppP-deficient strains

    • Use high-performance anion-exchange chromatography with pulsed amperometric detection (HPAEC-PAD) to quantify differences in cell wall polysaccharides

  • EPS Characterization:

    • Isolate and analyze EPS composition from strains with different uppP expression levels

    • Determine monosaccharide content, focusing on D-galactose, D-glucose, L-rhamnose, and D-mannose proportions

  • Stress Response Assessment:

    • Subject strains with varying uppP expression to acid stress, bile salts, and osmotic pressure

    • Measure survival rates and correlate with EPS production

    • Quantify cell surface hydrophobicity and auto-aggregation properties

  • Microscopic Analysis:

    • Use transmission electron microscopy to visualize cell wall and capsule thickness

    • Apply fluorescently labeled lectins to observe differences in surface glycans

This integrated approach can reveal whether uppP function influences EPS composition or production, potentially affecting the probiotic properties of B. longum.

How does Bifidobacterium longum subsp. infantis uppP differ from other Bifidobacterium species in terms of structure and function?

Comparing undecaprenyl-diphosphatase across Bifidobacterium species reveals important evolutionary adaptations. The following methodological approach is recommended for comparative analysis:

  • Sequence Alignment and Phylogenetic Analysis:

    • Align uppP sequences from multiple Bifidobacterium species

    • Construct phylogenetic trees to visualize evolutionary relationships

    • Identify species-specific variations in the conserved (E/Q)XXXE and PGXSRSXXT motifs

  • Homology Modeling:

    • Generate structural models for uppP from different species

    • Compare active site architecture and substrate binding pockets

    • Identify potential differences in membrane topology

  • Heterologous Expression:

    • Express uppP from different Bifidobacterium species under identical conditions

    • Compare expression levels, solubility, and purification yields

    • Assess enzymatic parameters (Km, kcat, pH optima) across species

  • Complementation Studies:

    • Express different Bifidobacterium uppP variants in a model organism with an uppP deletion

    • Compare the ability of each variant to restore normal phenotype

The comparative data can be summarized in a table format:

Bifidobacterium SpeciesKey Sequence VariationsEnzymatic ParametersHost SpecificityNotable Features
B. longum subsp. infantisReference sequenceKm = x μM, kcat = y s⁻¹Human infant gutAdaptation to milk oligosaccharides
B. longum subsp. longumVariations in positions...Km = x μM, kcat = y s⁻¹Human adult gutExtended persistence
B. animalisVariations in positions...Km = x μM, kcat = y s⁻¹Broader host rangeHigher rhamnose in EPS
Other species...............

This comprehensive comparison can provide insights into how uppP has evolved to support the ecological niches of different Bifidobacterium species.

What strategies can overcome the challenges in expressing and purifying active Bifidobacterium longum uppP?

As an integral membrane protein, Bifidobacterium longum uppP presents several challenges for recombinant expression and purification. Here are methodological solutions to common issues:

  • Low Expression Yields:

    • Problem: Standard expression systems often yield insufficient protein.

    • Solutions:

      • Use specialized strains like C41(DE3) or C43(DE3) specifically designed for membrane protein expression

      • Optimize codon usage for the expression host

      • Lower induction temperature to 20-25°C and extend expression time to 16-24 hours

      • Test different fusion partners, including bacteriorhodopsin, which has proven successful for other uppP proteins

  • Protein Insolubility:

    • Problem: Overexpressed uppP often forms inclusion bodies.

    • Solutions:

      • Screen multiple detergents (DDM, LMNG, CHAPS) at various concentrations for optimal solubilization

      • Test solubilization additives such as glycerol (10-20%) and specific lipids

      • Consider extraction using styrene maleic acid (SMA) copolymers to maintain the native lipid environment

  • Loss of Activity During Purification:

    • Problem: The enzyme loses activity during purification steps.

    • Solutions:

      • Incorporate essential divalent cations (Mg²⁺ or Ca²⁺) in all buffers

      • Add stabilizing agents such as glycerol and reducing agents

      • Minimize purification steps and process samples quickly at 4°C

      • Consider on-column detergent exchange to more stabilizing detergents

  • Protein Aggregation:

    • Problem: Purified protein tends to aggregate during storage.

    • Solutions:

      • Store at -80°C in buffer containing 50% glycerol

      • Add specific lipids that may stabilize the protein structure

      • Determine optimal protein concentration to avoid concentration-dependent aggregation

      • Consider flash-freezing small aliquots in liquid nitrogen

The successful expression and purification of active uppP typically requires empirical optimization of multiple parameters simultaneously.

How can researchers address variability in enzymatic activity assays for Bifidobacterium longum uppP?

Enzymatic activity assays for membrane proteins like uppP can show significant variability. Here's a methodological approach to minimize inconsistencies:

  • Standardization of Enzyme Preparation:

    • Use consistent purification protocols

    • Quantify protein concentration using multiple methods (Bradford, BCA, and A280)

    • Assess protein purity by SDS-PAGE and size exclusion chromatography

    • Prepare single-use aliquots to avoid freeze-thaw cycles

  • Substrate Considerations:

    • Use high-purity undecaprenyl pyrophosphate or its analogs (e.g., Farnesyl pyrophosphate)

    • Prepare fresh substrate solutions or store properly to prevent degradation

    • Validate substrate quality by HPLC before use

  • Assay Controls and Normalization:

    • Include positive controls (e.g., E. coli UppP) in each assay batch

    • Run negative controls with heat-inactivated enzyme

    • Normalize activity to the positive control to account for day-to-day variations

  • Optimization of Detection Method:

    • For Malachite Green phosphate detection:

      • Prepare fresh reagent and establish a new standard curve for each experiment

      • Account for potential interference from buffer components

      • Ensure measurements are within the linear range of detection

  • Statistical Approach:

    • Perform all assays in triplicate at minimum

    • Use statistical methods to identify and exclude outliers

    • Report both mean values and measures of dispersion (standard deviation)

    • Consider using robust statistical methods resistant to outliers

By implementing these methodological refinements, researchers can achieve more consistent and reliable enzymatic activity measurements for Bifidobacterium longum uppP.

What emerging technologies could advance our understanding of Bifidobacterium longum uppP's role in gut colonization?

Several cutting-edge methodologies show promise for elucidating the role of uppP in Bifidobacterium longum gut colonization:

  • In vivo Imaging Technologies:

    • Develop fluorescently tagged uppP variants that retain functionality

    • Use intravital microscopy to visualize B. longum colonization in animal models

    • Apply correlative light and electron microscopy to connect uppP localization with bacterial-host interactions

  • Single-Cell Technologies:

    • Employ single-cell RNA-Seq to assess uppP expression heterogeneity within B. longum populations

    • Use CyTOF or spectral flow cytometry to correlate uppP expression with other cellular parameters

    • Apply nanoscale secondary ion mass spectrometry (NanoSIMS) to track metabolic activities at the single-cell level

  • Microfluidic Systems:

    • Develop gut-on-a-chip models to study B. longum colonization under controlled conditions

    • Monitor real-time gene expression using reporter systems

    • Assess competitive fitness of wild-type versus uppP-modified strains

  • CRISPR-Based Tools:

    • Use CRISPR interference (CRISPRi) for tunable repression of uppP

    • Apply CRISPR activation (CRISPRa) for enhanced expression

    • Employ multiplexed CRISPR screens to identify genes that interact with uppP

  • Metabolomics Approaches:

    • Apply untargeted metabolomics to identify changes in the gut environment associated with uppP activity

    • Use stable isotope probing to track metabolic products linked to cell wall synthesis

    • Develop targeted metabolomics methods for undecaprenyl-linked intermediates

These innovative approaches could reveal how uppP contributes to the exceptional colonization abilities of Bifidobacterium longum and potentially lead to the development of enhanced probiotic strains.

How might computational approaches enhance the design of experiments investigating Bifidobacterium longum uppP?

Computational methods can significantly advance experimental design for uppP research:

By integrating these computational approaches with traditional experimental methods, researchers can develop more focused hypotheses and design more efficient experiments to elucidate the function and significance of Bifidobacterium longum uppP.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.