Recombinant Bifidobacterium longum undecaprenyl-diphosphatase (uppP) is a recombinant protein derived from the uppP gene (also known as bacA) in B. longum. This enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate (C₅₅-PP) to undecaprenyl phosphate (C₅₅-P), a critical step in bacterial cell wall biosynthesis. It is essential for recycling carrier lipids involved in peptidoglycan and teichoic acid synthesis .
The uppP gene encodes a 294-amino-acid protein (UniProt ID: Q8G6C4) with a molecular weight of ~33 kDa. Key features include:
| Property | Description |
|---|---|
| Gene Name | uppP (synonymous with bacA) |
| EC Number | EC 3.6.1.27 (undecaprenyl pyrophosphate phosphatase) |
| Function | Dephosphorylates C₅₅-PP to C₅₅-P for lipid carrier recycling |
| Expression Host | Recombinant B. longum NCC 2705 (strain BL0721) |
| Protein Sequence | MNFFQAIILGIVQALTEYLPVSSSAHIRIFGDLmLGSDPGAAFTAIIQIGTELAVILYFR HDIINILTHWFSCLFGKNGKDWKARMGRGDNYATLGWNIIVGSIPIIILGFTLQNVIETS LRNLWITVTVLLVFGILLWMVDAKARQNKTMNDMTYRDAFLFGLGQSMALIPGVSRSGGT ITVGRALGYTREAAVRLSFLMAIPAVFGSGLLEAIKAVKNYKTDAMFPGWGPTLVAMVIS FVLGYIVIIGFLKFVSNFSYKAFAIYRIGLAVVVALLLIVGVLPAIDPSVVAAA |
| Storage | Tris-based buffer, 50% glycerol, stored at -20°C or -80°C for long-term use |
Source: Recombinant protein specifications from ELISA kit data .
The recombinant uppP protein is expressed in B. longum NCC 2705 and purified using chromatographic methods. Key steps include:
Expression: Induction with isopropyl β-D-thiogalactoside (IPTG) and all-trans-retinal .
Purification: Membrane solubilization and ultracentrifugation to isolate the protein .
Applications:
| Residue/Region | Role in Enzymatic Activity |
|---|---|
| Histidine | Catalytic site (proton transfer) |
| Glutamate-rich motifs | (E/Q)XXXE and PGXSRSTXXT |
| C-terminal domain | Membrane anchoring and substrate binding |
Note: Motif data inferred from homologous E. coli UppP studies .
KEGG: blj:BLD_0446
Exopolysaccharide production in Bifidobacterium longum is governed by specific gene clusters called eps clusters. These clusters contain genes responsible for both sugar nucleotide production and EPS biosynthesis enzymes. Key genes involved in precursor sugar nucleotide synthesis include galK, galE, galT, galU, rmlA, rmlB1, and rmlCD, along with early glycosyltransferases. These genes have been identified in multiple B. longum subspecies and strains including NCC2705, DJO10A, and B. longum subsp. longum CRC 002 . The priming glycosyltransferase (PGTF) gene is particularly crucial as it initiates the assembly of EPS repeat units by adding the first sugar-1-phosphate to a lipophilic carrier .
Significant diversity exists in eps gene clusters among different Bifidobacterium longum strains. Research analyzing 48 bifidobacteria strains revealed considerable interspecies diversity among strains possessing eps clusters, particularly in terms of:
Cluster length variation
Number of genes within clusters
Predicted gene functions
The size of eps gene clusters varies substantially among Bifidobacterium strains, ranging from as few as 9 genes identified in the eps region of B. mongoliense to as many as 55 genes in B. dentium . This diversity in genetic structure contributes to the varying abilities of different strains to produce EPS with distinct structural and functional properties.
Bifidobacterium longum utilizes two main secretory systems for exporting synthesized exopolysaccharides to the extracellular environment:
ABC transporters
The flippase-polymerase complex (WZX-WZY)
Most eps clusters in Bifidobacterium strains indicate the existence of both systems. In the Wzx-Wzy-dependent pathway:
The protein flippase (Wzx) ejects the EPS repeat units bound to the lipid carrier across the membrane
A polymerase (Wzy) then transfers the repeating units outside the cell
The final chain length is determined by protein tyrosine kinase (Wzz)
This two-system approach enables efficient export of the synthesized EPS polymers to fulfill their biological functions on the cell surface.
Engineering recombinant B. longum strains with modified undecaprenyl-diphosphatase expression requires strategic genetic manipulation approaches:
Gene Replacement Strategy: Similar to the approach used with the Balat_1410 gene in B. animalis DSM10140T, researchers can replace the wild-type uppP gene with a mutant variant. This technique has proven effective, as demonstrated when the mucoid phenotype was restored through targeted gene replacement .
Point Mutation Introduction: Specific point mutations can be introduced to modify enzyme activity. For example, in B. animalis DSM10140T, introducing a point mutation into a gene involved in EPS chain elongation resulted in enhanced EPS production with higher molecular weight .
Expression Optimization: Targeting genes associated with nucleotide sugar production alongside uppP can significantly influence EPS production. As demonstrated in B. longum subsp. CRC002, directing expression of PGTF-related genes resulted in increased production of glucose and galactose-containing EPS .
| Engineering Approach | Technical Requirements | Expected Outcomes | Verification Methods |
|---|---|---|---|
| Gene Replacement | CRISPR-Cas9 or homologous recombination systems | Modified EPS production | NMR, SEC-MALS analysis |
| Point Mutation | Site-directed mutagenesis | Altered enzyme activity | Enzyme activity assays, phenotypic analysis |
| Expression Optimization | Promoter engineering, RBS modification | Enhanced production | Quantitative RT-PCR, product analysis |
Assessment of immunomodulatory effects requires a multi-faceted approach:
In vitro Immune Cell Assays: Co-culture experiments with peripheral blood mononuclear cells (PBMCs) can be performed to measure cytokine responses. Specifically, measuring the [IL10]:[IL12] ratio is valuable, with a ratio of at least 10 indicating significant immunomodulatory capacity .
Dendritic Cell Surface Marker Expression: Evaluate the expression of activation markers such as CD86 and HLA-DR on plasmacytoid dendritic cells (pDCs) through flow cytometry after co-culture with the recombinant strains. Research has shown that B. longum BB536 significantly increased the expression of these markers on pDCs .
Cytokine Gene Expression Analysis: Quantitative PCR can be used to measure expression levels of key cytokine genes including IFNγ, IFNα1, and IFNβ. Co-culture with heat-killed B. longum BB536 has demonstrated significant increases in IFNγ expression and trends toward increased IFNα1 and IFNβ expression .
Comparison with Isogenic EPS-Mutants: Create and compare wild-type strains that naturally produce EPS with isogenic strains lacking EPS (EPS-mutants). Studies with B. breve strains have shown that the absence of EPS can lead to differential cytokine responses in bone marrow-derived macrophages, with some strains showing increased TNF-α and IL10 production and others showing reduced responses .
The following analytical methods are most effective for characterizing EPS structural features:
Nuclear Magnetic Resonance (NMR) Spectroscopy: This technique provides detailed information about the monosaccharide composition, linkage patterns, and branching structures of EPS. It has been successfully applied to characterize EPS from mutant B. animalis strains .
Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS): This method accurately determines the molecular weight distribution of EPS polymers. It has revealed that mutant strains can produce EPS with higher molecular weight compared to wild-type strains .
Chemical Composition Analysis: Determines the monosaccharide components and their relative amounts. Studies have shown significant diversity in the monosaccharide components and their quantities across different bifidobacteria strains .
Glycosidic Bond Analysis: Evaluates the types of linkages between sugar units, which can vary significantly between strains and affect biological activity.
Optimizing experimental conditions is crucial for accurate evaluation of EPS production:
Culture Medium Composition: The carbon-nitrogen ratio significantly influences EPS production rates. Testing media with varying compositions is essential .
Environmental Parameters:
Growth Phase Monitoring: Gene expression for nucleotide sugar production peaks during the exponential growth phase, making this the optimal time for sampling and analysis .
Carbon Source Variation: Test different carbohydrate sources (glucose, lactose, maltose) as these affect EPS production. Studies with B. breve strains have shown differential EPS precipitation in media containing different carbon sources .
Strain Selection Controls: Include both wild-type and EPS-mutant strains as controls in experiments to provide reference points for comparative analysis .
| Parameter | Recommended Range | Monitoring Method | Importance |
|---|---|---|---|
| Temperature | 37°C ± 0.5°C | Continuous temperature logging | High |
| pH | 6.0-6.5 | pH electrode with automated control | High |
| Carbon source | Glucose, lactose, or maltose (10-20 g/L) | HPLC analysis | Medium |
| Growth phase | Mid to late exponential | OD600 measurements | High |
| Oxygen level | Anaerobic (<0.5% O2) | Oxygen sensors | Critical |
The effective isolation and purification of recombinant B. longum strains requires a systematic approach:
Selective Media Development: Design media containing appropriate selective markers based on the genetic modifications introduced. This may include antibiotic resistance markers or other selectable phenotypes.
Colony PCR Screening: Implement screening using primers derived from the target gene sequences. According to patent information, primers comprising at least 10 consecutive bases from specific nucleic acid sequences can be used for identification .
Phenotypic Confirmation: Verify EPS expression through visual observation of colony morphology. EPS-producing strains often display a mucoid phenotype on solid media .
Genetic Verification:
Functional Verification: Assess the immunomodulatory capacity through PBMC co-incubation assays, measuring the [IL10]:[IL12] ratio. A ratio of at least 10 at a concentration of 1×10^7 CFU/ml indicates successful isolation of the desired strain .
When designing experiments to evaluate the structure-function relationship of EPS:
Strain Selection Strategy: Include multiple strains of the same species with different EPS structures to directly compare immunomodulatory effects. Research has shown that even strains of the same species can produce structurally diverse EPS with differing immunomodulatory effects .
EPS Isolation Purity: Ensure high-purity EPS preparations to eliminate confounding factors from contaminants. This may require multiple purification steps and verification of purity.
Structural Characterization: Perform comprehensive structural analysis of EPS from each strain before immunological testing, including:
Immune Cell Diversity: Test effects on multiple immune cell types, as responses can vary. For instance, B. breve strains show differential effects on bone marrow-derived macrophages versus dendritic cells .
In vitro and In vivo Model Selection: Utilize both in vitro models (human, mouse, and rat PBMCs) and in vivo models to comprehensively assess immunomodulatory effects .
Cytokine Profile Breadth: Measure a wide range of cytokines rather than focusing on a limited set. Different EPS structures may preferentially modulate different cytokines or immune pathways.
When facing low EPS production in recombinant strains, consider these strategies:
Genetic Enhancement Approaches:
Target the priming glycosyltransferase (PGTF) gene expression, which is critical for initiating EPS synthesis
Optimize the expression of genes involved in nucleotide sugar production, which peak during exponential growth
Introduce point mutations in genes responsible for EPS chain elongation, which has successfully increased EPS molecular weight in B. animalis
Culture Condition Optimization:
Pathway Bottleneck Analysis:
Epigenetic Considerations:
Inconsistent immunomodulatory assay results may be addressed through:
Standardization of Bacterial Preparation:
Immune Cell Source Considerations:
Experimental Design Refinement:
Technical Protocol Optimization:
Strain Verification:
Common pitfalls and their solutions include:
Inefficient Transformation:
Problem: Low transformation efficiency in Bifidobacterium species
Solution: Optimize electroporation parameters specifically for B. longum; use strain-specific protocols; consider cell wall weakening treatments before transformation
Plasmid Instability:
Problem: Loss of plasmids during cultivation without selection pressure
Solution: Develop integration strategies to incorporate genes into the chromosome; use compatible origins of replication; maintain selection pressure throughout cultivation
Unintended Phenotypic Changes:
Problem: Genetic modifications affecting growth, stress resistance, or other traits
Solution: Thoroughly characterize modified strains; compare growth curves, stress responses, and metabolic profiles between wild-type and modified strains
Off-Target Effects in CRISPR-Cas Systems:
Problem: Unintended genomic modifications
Solution: Carefully design guide RNAs with minimal off-target potential; sequence the entire genome of modified strains to verify specificity
Incomplete Characterization of Modified Strains:
Problem: Insufficient verification of genetic changes and their effects
Solution: Implement comprehensive verification using multiple methods:
Analyzing the relationship between undecaprenyl-diphosphatase expression and cell wall integrity requires multi-faceted approaches:
Quantitative Gene Expression Analysis:
Use RT-qPCR to measure uppP expression levels under various conditions
Correlate expression levels with peptidoglycan synthesis rates
Microscopic Evaluation of Cell Wall Structure:
Implement transmission electron microscopy (TEM) to visualize cell wall thickness and integrity
Use fluorescent stains specific for peptidoglycan to assess cell wall composition via confocal microscopy
Cell Wall Stress Response Assessment:
Expose cells to cell wall stressors (lysozyme, antibiotics targeting cell wall synthesis)
Compare survival rates between wild-type and modified strains
Measure expression of stress response genes related to cell wall integrity
Peptidoglycan Composition Analysis:
Isolate and analyze peptidoglycan composition using HPLC or mass spectrometry
Compare cross-linking patterns between strains with different uppP expression levels
Correlation with EPS Production:
Advanced genomic approaches for identifying novel eps cluster variations include:
Comparative Genomics Pipeline:
Functional Genomics Integration:
Combine genomic data with transcriptomics to identify actively expressed eps genes
Correlate expression patterns with EPS production phenotypes
Identify regulatory elements controlling eps cluster expression
Pan-Genome Analysis:
Construct a B. longum pan-genome focusing on eps-related genes
Identify core and accessory genes within eps clusters
Determine strain-specific variations that may contribute to unique EPS structures
Synteny Analysis:
Examine the organization and arrangement of genes within eps clusters
Identify conserved gene blocks versus variable regions
Map evolutionary relationships between different eps cluster arrangements
CRISPR-Cas9 Screening:
Develop libraries targeting potential eps genes
Screen for phenotypic changes related to EPS production
Validate the functional importance of newly identified genes
| Genomic Approach | Primary Application | Output Data | Bioinformatic Tools |
|---|---|---|---|
| Whole Genome Sequencing | Comprehensive genetic mapping | Complete genome assemblies | SPAdes, Unicycler |
| RNA-Seq | Expression profiling | Transcriptional activity | DESeq2, EdgeR |
| ChIP-Seq | Regulatory element identification | Protein-DNA interactions | MACS2, Homer |
| SMRT Sequencing | Methylation pattern analysis | Epigenetic modifications | SMRT Analysis, methylKit |
| Hi-C | Chromatin conformation | 3D genome organization | HiC-Pro, Juicer |
Emerging applications for recombinant B. longum with modified EPS production include:
Precision Immunomodulation:
Development of strains with specifically tailored EPS structures to target particular immune responses
Creation of strains capable of inducing higher IL10:IL12 ratios for anti-inflammatory applications
Engineering strains that enhance dendritic cell activation through increased CD86 and HLA-DR expression
Enhanced Adherence Properties:
Modification of EPS structure to improve adherence to intestinal epithelial cells
Development of strains with EPS characteristics that enhance biofilm formation
Engineering of EPS to improve stability and persistence in the gastrointestinal tract
Targeted Delivery Systems:
Using recombinant B. longum as vehicles for delivering therapeutic compounds
Engineering the EPS layer to incorporate bioactive molecules
Development of strains with EPS characteristics that enable targeted release of compounds
Advanced Biotherapeutics:
Creating strains with EPS compositions that enhance specific health benefits
Engineering EPS structures that provide protection against specific pathogens
Development of strains with EPS characteristics that modulate other components of the microbiome
Research Tools:
Synthetic biology approaches offer promising avenues for precise EPS engineering:
Designer EPS Assembly Platforms:
Development of modular glycosyltransferase systems that can be combined to produce custom EPS structures
Creation of synthetic operons with optimized gene expression levels for consistent EPS production
Implementation of orthogonal ribosome binding sites to fine-tune expression of individual genes within eps clusters
CRISPR-Cas Multiplexing:
Simultaneous modification of multiple genes within eps clusters
Precise editing of glycosyltransferase domains to alter substrate specificity
Development of inducible CRISPR systems for temporal control of eps gene expression
Biosensor-Controlled EPS Production:
Integration of biosensor systems that detect environmental conditions
Development of feedback loops that adjust EPS production in response to specific stimuli
Creation of strains that modulate EPS structure in response to gut environmental cues
Computational Design Tools:
Development of algorithms predicting EPS structure based on glycosyltransferase combinations
In silico modeling of glycosyltransferase substrate specificities
Computational prediction of EPS-host interactions based on structural characteristics
Minimal Genome Approaches: