Recombinant Bifidobacterium longum Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bifidobacterium longum Undecaprenyl-diphosphatase (uppP)

Recombinant Bifidobacterium longum undecaprenyl-diphosphatase (uppP) is a recombinant protein derived from the uppP gene (also known as bacA) in B. longum. This enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate (C₅₅-PP) to undecaprenyl phosphate (C₅₅-P), a critical step in bacterial cell wall biosynthesis. It is essential for recycling carrier lipids involved in peptidoglycan and teichoic acid synthesis .

Gene and Protein Properties

The uppP gene encodes a 294-amino-acid protein (UniProt ID: Q8G6C4) with a molecular weight of ~33 kDa. Key features include:

PropertyDescription
Gene NameuppP (synonymous with bacA)
EC NumberEC 3.6.1.27 (undecaprenyl pyrophosphate phosphatase)
FunctionDephosphorylates C₅₅-PP to C₅₅-P for lipid carrier recycling
Expression HostRecombinant B. longum NCC 2705 (strain BL0721)
Protein SequenceMNFFQAIILGIVQALTEYLPVSSSAHIRIFGDLmLGSDPGAAFTAIIQIGTELAVILYFR HDIINILTHWFSCLFGKNGKDWKARMGRGDNYATLGWNIIVGSIPIIILGFTLQNVIETS LRNLWITVTVLLVFGILLWMVDAKARQNKTMNDMTYRDAFLFGLGQSMALIPGVSRSGGT ITVGRALGYTREAAVRLSFLMAIPAVFGSGLLEAIKAVKNYKTDAMFPGWGPTLVAMVIS FVLGYIVIIGFLKFVSNFSYKAFAIYRIGLAVVVALLLIVGVLPAIDPSVVAAA
StorageTris-based buffer, 50% glycerol, stored at -20°C or -80°C for long-term use

Source: Recombinant protein specifications from ELISA kit data .

Recombinant Production and Purification

The recombinant uppP protein is expressed in B. longum NCC 2705 and purified using chromatographic methods. Key steps include:

  1. Expression: Induction with isopropyl β-D-thiogalactoside (IPTG) and all-trans-retinal .

  2. Purification: Membrane solubilization and ultracentrifugation to isolate the protein .

  3. Applications:

    • ELISA Development: Used as an antigen in enzyme-linked immunosorbent assays to detect antibodies against B. longum uppP .

    • Functional Studies: Investigating lipid carrier recycling in B. longum cell wall synthesis.

Key Residues and Motifs in uppP

Residue/RegionRole in Enzymatic Activity
HistidineCatalytic site (proton transfer)
Glutamate-rich motifs(E/Q)XXXE and PGXSRSTXXT
C-terminal domainMembrane anchoring and substrate binding

Note: Motif data inferred from homologous E. coli UppP studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can serve as a reference for your usage.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; BLD_0446; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-294
Protein Length
full length protein
Species
Bifidobacterium longum (strain DJO10A)
Target Names
uppP
Target Protein Sequence
MNFFQAIILGIVQALTEYLPVSSSAHIRIFGDLMLGSDPGAAFTAIIQIGTELAVILYFR HDIINILTHWFSCLFGKNGKDWKARMGRGDNYATLGWNIIVGSIPIIILGFTLQNVIETS LRNLWITVTVLLVFGILLWMVDAKARQNKTMNDMTYRDAFLFGLGQSMALIPGVSRSGGT ITVGRALGYTREAAVRLSFLMAIPAVFGSGLLEAIKAVKNYKTDAMFPGWGPTLVAMVIS FVLGYIVIIGFLKFVSNFSYKAFAIYRIGLAVVVALLLIVGVLPAIDPSVVAAA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: blj:BLD_0446

Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genetic basis for exopolysaccharide (EPS) production in Bifidobacterium longum?

Exopolysaccharide production in Bifidobacterium longum is governed by specific gene clusters called eps clusters. These clusters contain genes responsible for both sugar nucleotide production and EPS biosynthesis enzymes. Key genes involved in precursor sugar nucleotide synthesis include galK, galE, galT, galU, rmlA, rmlB1, and rmlCD, along with early glycosyltransferases. These genes have been identified in multiple B. longum subspecies and strains including NCC2705, DJO10A, and B. longum subsp. longum CRC 002 . The priming glycosyltransferase (PGTF) gene is particularly crucial as it initiates the assembly of EPS repeat units by adding the first sugar-1-phosphate to a lipophilic carrier .

How do Bifidobacterium longum strains differ in their eps gene clusters?

Significant diversity exists in eps gene clusters among different Bifidobacterium longum strains. Research analyzing 48 bifidobacteria strains revealed considerable interspecies diversity among strains possessing eps clusters, particularly in terms of:

  • Cluster length variation

  • Number of genes within clusters

  • Predicted gene functions

The size of eps gene clusters varies substantially among Bifidobacterium strains, ranging from as few as 9 genes identified in the eps region of B. mongoliense to as many as 55 genes in B. dentium . This diversity in genetic structure contributes to the varying abilities of different strains to produce EPS with distinct structural and functional properties.

What are the primary secretory systems involved in exopolysaccharide transport in Bifidobacterium longum?

Bifidobacterium longum utilizes two main secretory systems for exporting synthesized exopolysaccharides to the extracellular environment:

  • ABC transporters

  • The flippase-polymerase complex (WZX-WZY)

Most eps clusters in Bifidobacterium strains indicate the existence of both systems. In the Wzx-Wzy-dependent pathway:

  • The protein flippase (Wzx) ejects the EPS repeat units bound to the lipid carrier across the membrane

  • A polymerase (Wzy) then transfers the repeating units outside the cell

  • The final chain length is determined by protein tyrosine kinase (Wzz)

This two-system approach enables efficient export of the synthesized EPS polymers to fulfill their biological functions on the cell surface.

What approaches can be used to engineer recombinant Bifidobacterium longum strains with modified undecaprenyl-diphosphatase (uppP) expression?

Engineering recombinant B. longum strains with modified undecaprenyl-diphosphatase expression requires strategic genetic manipulation approaches:

  • Gene Replacement Strategy: Similar to the approach used with the Balat_1410 gene in B. animalis DSM10140T, researchers can replace the wild-type uppP gene with a mutant variant. This technique has proven effective, as demonstrated when the mucoid phenotype was restored through targeted gene replacement .

  • Point Mutation Introduction: Specific point mutations can be introduced to modify enzyme activity. For example, in B. animalis DSM10140T, introducing a point mutation into a gene involved in EPS chain elongation resulted in enhanced EPS production with higher molecular weight .

  • Expression Optimization: Targeting genes associated with nucleotide sugar production alongside uppP can significantly influence EPS production. As demonstrated in B. longum subsp. CRC002, directing expression of PGTF-related genes resulted in increased production of glucose and galactose-containing EPS .

Engineering ApproachTechnical RequirementsExpected OutcomesVerification Methods
Gene ReplacementCRISPR-Cas9 or homologous recombination systemsModified EPS productionNMR, SEC-MALS analysis
Point MutationSite-directed mutagenesisAltered enzyme activityEnzyme activity assays, phenotypic analysis
Expression OptimizationPromoter engineering, RBS modificationEnhanced productionQuantitative RT-PCR, product analysis

How can researchers assess the immunomodulatory effects of recombinant Bifidobacterium longum strains with modified uppP expression?

Assessment of immunomodulatory effects requires a multi-faceted approach:

  • In vitro Immune Cell Assays: Co-culture experiments with peripheral blood mononuclear cells (PBMCs) can be performed to measure cytokine responses. Specifically, measuring the [IL10]:[IL12] ratio is valuable, with a ratio of at least 10 indicating significant immunomodulatory capacity .

  • Dendritic Cell Surface Marker Expression: Evaluate the expression of activation markers such as CD86 and HLA-DR on plasmacytoid dendritic cells (pDCs) through flow cytometry after co-culture with the recombinant strains. Research has shown that B. longum BB536 significantly increased the expression of these markers on pDCs .

  • Cytokine Gene Expression Analysis: Quantitative PCR can be used to measure expression levels of key cytokine genes including IFNγ, IFNα1, and IFNβ. Co-culture with heat-killed B. longum BB536 has demonstrated significant increases in IFNγ expression and trends toward increased IFNα1 and IFNβ expression .

  • Comparison with Isogenic EPS-Mutants: Create and compare wild-type strains that naturally produce EPS with isogenic strains lacking EPS (EPS-mutants). Studies with B. breve strains have shown that the absence of EPS can lead to differential cytokine responses in bone marrow-derived macrophages, with some strains showing increased TNF-α and IL10 production and others showing reduced responses .

What methods are most effective for analyzing the structural characteristics of exopolysaccharides produced by recombinant Bifidobacterium longum?

The following analytical methods are most effective for characterizing EPS structural features:

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: This technique provides detailed information about the monosaccharide composition, linkage patterns, and branching structures of EPS. It has been successfully applied to characterize EPS from mutant B. animalis strains .

  • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS): This method accurately determines the molecular weight distribution of EPS polymers. It has revealed that mutant strains can produce EPS with higher molecular weight compared to wild-type strains .

  • Chemical Composition Analysis: Determines the monosaccharide components and their relative amounts. Studies have shown significant diversity in the monosaccharide components and their quantities across different bifidobacteria strains .

  • Glycosidic Bond Analysis: Evaluates the types of linkages between sugar units, which can vary significantly between strains and affect biological activity.

What are the optimal experimental conditions for evaluating exopolysaccharide production in recombinant Bifidobacterium longum strains?

Optimizing experimental conditions is crucial for accurate evaluation of EPS production:

  • Culture Medium Composition: The carbon-nitrogen ratio significantly influences EPS production rates. Testing media with varying compositions is essential .

  • Environmental Parameters:

    • Temperature: Maintain consistent temperature, as variation affects EPS production

    • pH: Monitor and control pH throughout cultivation

    • Oxygen levels: Maintain anaerobic conditions appropriate for Bifidobacterium growth

  • Growth Phase Monitoring: Gene expression for nucleotide sugar production peaks during the exponential growth phase, making this the optimal time for sampling and analysis .

  • Carbon Source Variation: Test different carbohydrate sources (glucose, lactose, maltose) as these affect EPS production. Studies with B. breve strains have shown differential EPS precipitation in media containing different carbon sources .

  • Strain Selection Controls: Include both wild-type and EPS-mutant strains as controls in experiments to provide reference points for comparative analysis .

ParameterRecommended RangeMonitoring MethodImportance
Temperature37°C ± 0.5°CContinuous temperature loggingHigh
pH6.0-6.5pH electrode with automated controlHigh
Carbon sourceGlucose, lactose, or maltose (10-20 g/L)HPLC analysisMedium
Growth phaseMid to late exponentialOD600 measurementsHigh
Oxygen levelAnaerobic (<0.5% O2)Oxygen sensorsCritical

How can researchers effectively isolate and purify recombinant Bifidobacterium longum strains expressing modified undecaprenyl-diphosphatase?

The effective isolation and purification of recombinant B. longum strains requires a systematic approach:

  • Selective Media Development: Design media containing appropriate selective markers based on the genetic modifications introduced. This may include antibiotic resistance markers or other selectable phenotypes.

  • Colony PCR Screening: Implement screening using primers derived from the target gene sequences. According to patent information, primers comprising at least 10 consecutive bases from specific nucleic acid sequences can be used for identification .

  • Phenotypic Confirmation: Verify EPS expression through visual observation of colony morphology. EPS-producing strains often display a mucoid phenotype on solid media .

  • Genetic Verification:

    • Extract nucleic acids from candidate colonies

    • Amplify target regions using specific primers derived from sequences such as SEQ ID No. 2, SEQ ID No. 3, and others listed in the patent information

    • Sequence the amplified regions to confirm the presence of the desired modifications

  • Functional Verification: Assess the immunomodulatory capacity through PBMC co-incubation assays, measuring the [IL10]:[IL12] ratio. A ratio of at least 10 at a concentration of 1×10^7 CFU/ml indicates successful isolation of the desired strain .

What are the critical factors to consider when designing experiments to evaluate the relationship between exopolysaccharide structure and immunomodulatory function?

When designing experiments to evaluate the structure-function relationship of EPS:

  • Strain Selection Strategy: Include multiple strains of the same species with different EPS structures to directly compare immunomodulatory effects. Research has shown that even strains of the same species can produce structurally diverse EPS with differing immunomodulatory effects .

  • EPS Isolation Purity: Ensure high-purity EPS preparations to eliminate confounding factors from contaminants. This may require multiple purification steps and verification of purity.

  • Structural Characterization: Perform comprehensive structural analysis of EPS from each strain before immunological testing, including:

    • Monosaccharide composition

    • Glycosidic bond patterns

    • Degree of branching

    • Molecular weight distribution

  • Immune Cell Diversity: Test effects on multiple immune cell types, as responses can vary. For instance, B. breve strains show differential effects on bone marrow-derived macrophages versus dendritic cells .

  • In vitro and In vivo Model Selection: Utilize both in vitro models (human, mouse, and rat PBMCs) and in vivo models to comprehensively assess immunomodulatory effects .

  • Cytokine Profile Breadth: Measure a wide range of cytokines rather than focusing on a limited set. Different EPS structures may preferentially modulate different cytokines or immune pathways.

What strategies can address low exopolysaccharide production in recombinant Bifidobacterium longum strains?

When facing low EPS production in recombinant strains, consider these strategies:

  • Genetic Enhancement Approaches:

    • Target the priming glycosyltransferase (PGTF) gene expression, which is critical for initiating EPS synthesis

    • Optimize the expression of genes involved in nucleotide sugar production, which peak during exponential growth

    • Introduce point mutations in genes responsible for EPS chain elongation, which has successfully increased EPS molecular weight in B. animalis

  • Culture Condition Optimization:

    • Adjust the carbon-nitrogen ratio, which significantly influences EPS production rates

    • Test different carbon sources (glucose, lactose, maltose) to identify optimal conditions for your specific strain

    • Fine-tune environmental parameters including temperature, pH, and oxygen levels

  • Pathway Bottleneck Analysis:

    • Assess expression levels of all genes in the EPS biosynthetic pathway to identify rate-limiting steps

    • Specifically examine the two secretory systems (ABC transporters and the WZX-WZY complex) to ensure efficient EPS export

  • Epigenetic Considerations:

    • Evaluate potential epigenetic factors affecting gene expression

    • Consider environmental stimuli that may trigger enhanced EPS production as a stress response

How can researchers troubleshoot inconsistent results in immunomodulatory assays using recombinant Bifidobacterium longum strains?

Inconsistent immunomodulatory assay results may be addressed through:

  • Standardization of Bacterial Preparation:

    • Use consistent methods for preparing bacteria (live vs. heat-killed)

    • Standardize bacterial concentrations (e.g., 1×10^7 CFU/ml has been shown to induce reliable IL10:IL12 ratios)

    • Control the growth phase of bacteria used in assays, as this affects surface molecule expression

  • Immune Cell Source Considerations:

    • Account for donor variability when using primary human cells

    • Consider using standardized cell lines for initial screening

    • Ensure consistent isolation protocols for PBMCs or other immune cells

  • Experimental Design Refinement:

    • Include appropriate positive and negative controls in each experiment

    • Use isogenic EPS-mutant strains as controls to isolate the effects of EPS

    • Test different incubation times, as cytokine responses may vary temporally

  • Technical Protocol Optimization:

    • Validate antibodies and reagents used in flow cytometry or ELISA assays

    • Ensure consistent cell culture conditions including medium composition and serum source

    • Consider testing multiple readout methods (e.g., ELISA, qPCR, flow cytometry) to confirm results

  • Strain Verification:

    • Regularly confirm the genetic stability of recombinant strains

    • Verify EPS production and structure before each immunological experiment

    • Document any phenotypic changes in the bacterial strains over passages

What are the common pitfalls in designing genetic modification strategies for Bifidobacterium longum and how can they be overcome?

Common pitfalls and their solutions include:

  • Inefficient Transformation:

    • Problem: Low transformation efficiency in Bifidobacterium species

    • Solution: Optimize electroporation parameters specifically for B. longum; use strain-specific protocols; consider cell wall weakening treatments before transformation

  • Plasmid Instability:

    • Problem: Loss of plasmids during cultivation without selection pressure

    • Solution: Develop integration strategies to incorporate genes into the chromosome; use compatible origins of replication; maintain selection pressure throughout cultivation

  • Unintended Phenotypic Changes:

    • Problem: Genetic modifications affecting growth, stress resistance, or other traits

    • Solution: Thoroughly characterize modified strains; compare growth curves, stress responses, and metabolic profiles between wild-type and modified strains

  • Off-Target Effects in CRISPR-Cas Systems:

    • Problem: Unintended genomic modifications

    • Solution: Carefully design guide RNAs with minimal off-target potential; sequence the entire genome of modified strains to verify specificity

  • Incomplete Characterization of Modified Strains:

    • Problem: Insufficient verification of genetic changes and their effects

    • Solution: Implement comprehensive verification using multiple methods:

      • PCR and sequencing to confirm genetic modifications

      • Transcriptomic analysis to assess effects on global gene expression

      • Proteomic analysis to confirm protein production

      • Functional assays to verify phenotypic changes

How can researchers effectively analyze the relationship between uppP expression levels and cell wall integrity in Bifidobacterium longum?

Analyzing the relationship between undecaprenyl-diphosphatase expression and cell wall integrity requires multi-faceted approaches:

  • Quantitative Gene Expression Analysis:

    • Use RT-qPCR to measure uppP expression levels under various conditions

    • Correlate expression levels with peptidoglycan synthesis rates

  • Microscopic Evaluation of Cell Wall Structure:

    • Implement transmission electron microscopy (TEM) to visualize cell wall thickness and integrity

    • Use fluorescent stains specific for peptidoglycan to assess cell wall composition via confocal microscopy

  • Cell Wall Stress Response Assessment:

    • Expose cells to cell wall stressors (lysozyme, antibiotics targeting cell wall synthesis)

    • Compare survival rates between wild-type and modified strains

    • Measure expression of stress response genes related to cell wall integrity

  • Peptidoglycan Composition Analysis:

    • Isolate and analyze peptidoglycan composition using HPLC or mass spectrometry

    • Compare cross-linking patterns between strains with different uppP expression levels

  • Correlation with EPS Production:

    • Investigate potential relationships between cell wall integrity and EPS production

    • Determine if changes in uppP expression affect EPS attachment to the cell surface

What advanced genomic approaches can be used to identify novel eps cluster variations in Bifidobacterium longum strains?

Advanced genomic approaches for identifying novel eps cluster variations include:

  • Comparative Genomics Pipeline:

    • Sequence multiple B. longum strains using next-generation sequencing

    • Implement bioinformatic tools to identify and compare eps clusters across strains

    • Use the priming glycosyltransferase (p-gtf) sequence as a molecular marker to retrieve eps genome sequences, as demonstrated in previous research

  • Functional Genomics Integration:

    • Combine genomic data with transcriptomics to identify actively expressed eps genes

    • Correlate expression patterns with EPS production phenotypes

    • Identify regulatory elements controlling eps cluster expression

  • Pan-Genome Analysis:

    • Construct a B. longum pan-genome focusing on eps-related genes

    • Identify core and accessory genes within eps clusters

    • Determine strain-specific variations that may contribute to unique EPS structures

  • Synteny Analysis:

    • Examine the organization and arrangement of genes within eps clusters

    • Identify conserved gene blocks versus variable regions

    • Map evolutionary relationships between different eps cluster arrangements

  • CRISPR-Cas9 Screening:

    • Develop libraries targeting potential eps genes

    • Screen for phenotypic changes related to EPS production

    • Validate the functional importance of newly identified genes

Genomic ApproachPrimary ApplicationOutput DataBioinformatic Tools
Whole Genome SequencingComprehensive genetic mappingComplete genome assembliesSPAdes, Unicycler
RNA-SeqExpression profilingTranscriptional activityDESeq2, EdgeR
ChIP-SeqRegulatory element identificationProtein-DNA interactionsMACS2, Homer
SMRT SequencingMethylation pattern analysisEpigenetic modificationsSMRT Analysis, methylKit
Hi-CChromatin conformation3D genome organizationHiC-Pro, Juicer

What are the emerging applications of recombinant Bifidobacterium longum strains with modified exopolysaccharide production?

Emerging applications for recombinant B. longum with modified EPS production include:

  • Precision Immunomodulation:

    • Development of strains with specifically tailored EPS structures to target particular immune responses

    • Creation of strains capable of inducing higher IL10:IL12 ratios for anti-inflammatory applications

    • Engineering strains that enhance dendritic cell activation through increased CD86 and HLA-DR expression

  • Enhanced Adherence Properties:

    • Modification of EPS structure to improve adherence to intestinal epithelial cells

    • Development of strains with EPS characteristics that enhance biofilm formation

    • Engineering of EPS to improve stability and persistence in the gastrointestinal tract

  • Targeted Delivery Systems:

    • Using recombinant B. longum as vehicles for delivering therapeutic compounds

    • Engineering the EPS layer to incorporate bioactive molecules

    • Development of strains with EPS characteristics that enable targeted release of compounds

  • Advanced Biotherapeutics:

    • Creating strains with EPS compositions that enhance specific health benefits

    • Engineering EPS structures that provide protection against specific pathogens

    • Development of strains with EPS characteristics that modulate other components of the microbiome

  • Research Tools:

    • Development of reporter strains that change EPS production in response to environmental conditions

    • Creation of model systems for studying bacterial-host interactions

    • Engineering strains that allow visualization of EPS production in real-time

How might advances in synthetic biology facilitate more precise engineering of Bifidobacterium longum exopolysaccharide structures?

Synthetic biology approaches offer promising avenues for precise EPS engineering:

  • Designer EPS Assembly Platforms:

    • Development of modular glycosyltransferase systems that can be combined to produce custom EPS structures

    • Creation of synthetic operons with optimized gene expression levels for consistent EPS production

    • Implementation of orthogonal ribosome binding sites to fine-tune expression of individual genes within eps clusters

  • CRISPR-Cas Multiplexing:

    • Simultaneous modification of multiple genes within eps clusters

    • Precise editing of glycosyltransferase domains to alter substrate specificity

    • Development of inducible CRISPR systems for temporal control of eps gene expression

  • Biosensor-Controlled EPS Production:

    • Integration of biosensor systems that detect environmental conditions

    • Development of feedback loops that adjust EPS production in response to specific stimuli

    • Creation of strains that modulate EPS structure in response to gut environmental cues

  • Computational Design Tools:

    • Development of algorithms predicting EPS structure based on glycosyltransferase combinations

    • In silico modeling of glycosyltransferase substrate specificities

    • Computational prediction of EPS-host interactions based on structural characteristics

  • Minimal Genome Approaches:

    • Creation of B. longum chassis strains with streamlined genomes

    • Reduction of competing metabolic pathways to increase carbon flux toward EPS production

    • Development of strains with simplified genetic backgrounds for predictable engineering outcomes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.