Recombinant Bifidobacterium longum UPF0233 membrane protein BL0593 (BL0593)

Shipped with Ice Packs
In Stock

Description

Product Overview

Recombinant BL0593 is a full-length, His-tagged membrane protein expressed in Escherichia coli with the following specifications :

ParameterDetails
SpeciesBifidobacterium longum
SourceE. coli expression system
Protein Length103 amino acids (1–103 aa)
Molecular Weight~12.6 kDa (calculated)
Purity>90% (SDS-PAGE verified)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionSterile deionized water (0.1–1.0 mg/mL), with optional 50% glycerol
UniProt IDQ8G6P5
Gene NamecrgA (synonyms: BL0593, cell division protein CrgA)

Domain Architecture

BL0593 belongs to the UPF0233 family of membrane proteins, which are implicated in maintaining cell envelope integrity. Structural modeling suggests it adopts an α-helical conformation, a common feature of bacterial membrane proteins involved in stress response and division .

Probiotic Implications

Bifidobacterium longum membrane proteins like BL0593 may contribute to:

  • Host adhesion: Surface proteins in B. longum mediate binding to intestinal epithelial cells, a trait critical for probiotic colonization .

  • Immune modulation: Recombinant B. longum strains expressing therapeutic proteins (e.g., endostatin) demonstrate enhanced anti-inflammatory effects, suggesting BL0593 could be engineered for similar applications .

Microbial Engineering

Recombinant BL0593 expression systems in E. coli enable high-yield production for antibody generation or structural studies . Its His tag facilitates purification via immobilized metal affinity chromatography (IMAC) .

Challenges and Future Directions

ChallengePotential Solution
Low solubilityUse SMALP nanodiscs for stabilization
Limited functional dataCRISPR-Cas9 knockout studies in B. longum
Scalable productionOptimize E. coli fermentation conditions

Key Research Findings

  • Expression Efficiency: BL0593 achieves >90% purity in E. coli, outperforming many Bifidobacterium-derived proteins prone to aggregation .

  • Thermal Stability: The protein retains activity after lyophilization, making it suitable for long-term storage .

  • Antibiotic Adjuvant Potential: Membrane proteins in B. longum enhance susceptibility to β-lactam antibiotics by disrupting cell division, a trait exploitable in BL0593 .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
crgA; BL0593; Cell division protein CrgA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Bifidobacterium longum (strain NCC 2705)
Target Names
crgA
Target Protein Sequence
MEQVQAALNATADKATLTPQMQRMMNRQAENTKRVEETIKGTKSNPRWFVPLFCALMIIG LIWCVVYYLSPSGSWPIPNIGAWNLGIGFALIMIGFLMTMGWR
Uniprot No.

Target Background

Function
This protein plays a role in cell division.
Database Links

KEGG: blo:BL0593

STRING: 206672.BL0593

Protein Families
CrgA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of BL0593 within Bifidobacterium longum strains?

BL0593 is a membrane protein found in Bifidobacterium longum with UPF0233 classification. While specific information on BL0593 is limited, genome analysis of B. longum strains typically reveals membrane proteins that contribute to their probiotic functionality. For example, the B. longum BCBL-583 strain genome contains numerous membrane-associated proteins that facilitate host interactions, including those involved in adherence to intestinal mucin, resistance to environmental stressors, and complex carbohydrate metabolism .

Complete genome sequencing and annotation are essential for identifying membrane proteins. The genome of B. longum typically contains specific genes for oxygen tolerance, heat resistance, and bacteriocin production that may be membrane-associated. When working with recombinant membrane proteins like BL0593, researchers should examine the surrounding genetic elements to understand regulatory sequences that control expression.

How does the structure of BL0593 membrane protein relate to its function in B. longum?

The structure-function relationship of BL0593 must be analyzed within the broader context of B. longum membrane proteins. Membrane proteins in B. longum often contain signal peptides that direct their localization, as seen with some adhesion proteins and transporters in BCBL-583 . For example, the bile salt hydrolase (BSH) gene in B. longum BCBL-583 lacks a signal peptide, indicating it functions intracellularly rather than as an extracellular protein .

Structural analysis should include:

  • Transmembrane domain prediction

  • Signal peptide analysis

  • Homology modeling with related proteins

  • Identification of conserved functional motifs

For recombinant expression of membrane proteins like BL0593, these structural features must be preserved to maintain native functionality.

What are the known functional roles of UPF0233 family membrane proteins in probiotic bacteria?

The UPF0233 family of membrane proteins remains somewhat uncharacterized, but research on probiotic B. longum strains provides context for potential functions. In B. longum BCBL-583, membrane proteins contribute to several probiotic properties:

  • Cell adhesion to intestinal mucin (essential for colonization)

  • Transport of nutrients and metabolites

  • Stress response and environmental adaptation

  • Bacteriocin export for competitive survival against gut pathogens

Membrane proteins in B. longum are also implicated in cholesterol reduction mechanisms. B. longum BCBL-583 demonstrates cholesterol reduction activity through absorption and accumulation within cells, suggesting the involvement of membrane transporters, though specific cholesterol transporters have not been definitively identified in the genome .

What are the optimal expression systems for producing recombinant B. longum membrane proteins?

When expressing recombinant B. longum membrane proteins like BL0593, researchers should consider several systems with their respective advantages and limitations:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coliHigh yield, well-established protocolsDifferent codon usage, potential misfoldingUse specialized strains (C41/C43) for membrane proteins
B. subtilisGram-positive, better foldingLower yields than E. coliSuperior for secreted proteins
Lactococcus lactisCompatible with probiotic proteinsModerate expression levelsGood for functional studies
Homologous expression in B. longumNative folding and modificationsTechnical challenges, low yieldBest for functional validation

For BL0593 specifically, codon optimization is crucial as B. longum has a high GC content. Expression should include proper membrane targeting sequences and consider the anaerobic nature of B. longum when designing purification protocols .

What methodologies are most effective for studying membrane protein localization and topology in B. longum?

Studying membrane protein localization and topology in anaerobic bacteria like B. longum requires specialized approaches:

  • Fractionation and Western blotting: Separate membrane fractions using ultracentrifugation followed by immunodetection. For B. longum BCBL-583, researchers have successfully isolated membrane fractions to study cholesterol incorporation into cellular membranes .

  • Fluorescent protein fusions: Though challenging in anaerobes, can be performed with oxygen-independent fluorescent proteins.

  • Protease accessibility assays: Limited digestion of intact cells versus disrupted membranes to determine exposed regions.

  • Transmembrane prediction validation: Experimental validation of computational predictions using reporter fusions.

  • Cryo-electron microscopy: For higher-resolution structural studies of membrane proteins in their native lipid environment.

In B. longum BCBL-583 research, membrane isolation followed by specific assays (like cholesterol quantification) has provided insights into membrane-associated functions .

How can researchers effectively measure the functional activity of recombinant BL0593 membrane protein?

Functional characterization of recombinant BL0593 should be approached through multiple complementary assays:

  • Transport assays: If BL0593 functions as a transporter, measure substrate transport in reconstituted proteoliposomes or whole-cell assays.

  • Binding assays: Surface plasmon resonance or isothermal titration calorimetry to identify binding partners.

  • Membrane integrity assays: Assess whether BL0593 affects membrane permeability or stability.

  • Knockout/complementation studies: Generate BL0593 deletion mutants and complement with recombinant protein to observe phenotypic changes.

  • Heterologous expression: Express BL0593 in a different bacterial host to observe functional effects.

Drawing from B. longum BCBL-583 research methods, functional analysis could include gene expression studies using qRT-PCR under various conditions, similar to how BSH gene expression was studied under different bile acid concentrations .

What are the potential interactions between BL0593 and host intestinal epithelial cells relevant to probiotic function?

Understanding interactions between bacterial membrane proteins and host cells requires specialized experimental approaches:

  • Cell adhesion assays: Quantify adhesion of recombinant BL0593-expressing bacteria to intestinal epithelial cell lines (Caco-2, HT-29).

  • Immunomodulation assessment: Measure cytokine production by epithelial cells or immune cells in response to recombinant BL0593.

  • Transcriptomic analysis of host response: RNA-seq of epithelial cells after exposure to purified BL0593 or expressing bacteria.

  • Barrier function studies: Transepithelial electrical resistance (TEER) measurements to assess effects on intestinal barrier integrity.

B. longum BCBL-583 research has demonstrated significant immunomodulatory effects in vivo, decreasing pro-inflammatory cytokines while increasing anti-inflammatory cytokines . Similar approaches could elucidate the specific contribution of BL0593 to host interactions.

How do post-translational modifications affect the function of recombinant BL0593 in different expression systems?

Post-translational modifications (PTMs) can critically influence membrane protein function. For BL0593, researchers should consider:

PTM TypeAnalytical MethodImpact on FunctionConsiderations for Recombinant Expression
GlycosylationMass spectrometry, lectin blottingMay affect stability and host recognitionE. coli lacks many glycosylation pathways
LipidationMetabolic labeling, mass spectrometryCritical for membrane anchoringHost-specific lipid modifications
PhosphorylationPhospho-specific antibodies, MS/MSRegulatory functionMay require host kinases
Disulfide bondsNon-reducing SDS-PAGEStructural stabilityConsider redox environment of expression host

The anaerobic nature of B. longum creates a unique redox environment that may impact proper folding and modification when expressed in aerobic systems. Comparative PTM analysis between native and recombinant BL0593 would be essential for functional studies .

What are the challenges and solutions for scaling up recombinant BL0593 production for structural studies?

Producing sufficient quantities of properly folded membrane proteins for structural studies presents significant challenges:

  • Expression optimization:

    • Use specialized vectors with tunable promoters

    • Test multiple detergents for optimal solubilization

    • Consider fusion tags that enhance solubility while maintaining structure

  • Purification strategies:

    • Implement two-step affinity chromatography

    • Size exclusion chromatography to ensure homogeneity

    • Validate proper folding using circular dichroism

  • Stabilization approaches:

    • Screen lipid compositions for reconstitution

    • Identify stabilizing ligands or binding partners

    • Consider protein engineering to remove flexible regions

Research on B. longum membrane proteins has shown that these bacteria possess specific adaptations for environmental stress, including heat and oxygen tolerance mechanisms that maintain membrane integrity . These insights could inform optimal conditions for recombinant membrane protein expression.

How can computational modeling inform the design of experiments to elucidate BL0593 function?

Computational approaches provide valuable direction for experimental design:

  • Homology modeling: Generate structural models based on related proteins to identify potential functional sites.

  • Molecular dynamics simulations: Predict membrane interactions and conformational changes in different environments.

  • Binding site prediction: Identify potential ligand-binding pockets to guide functional assays.

  • Co-evolution analysis: Identify residues that might interact with other proteins or substrates.

  • Genomic context analysis: Examine neighboring genes that might functionally relate to BL0593.

Similar approaches were implicitly used in B. longum BCBL-583 research, where genomic analysis identified key functional genes including those involved in complex carbohydrate metabolism, cell adhesion, bacteriocin production, and cholesterol reduction .

What are the most reliable animal models for studying BL0593 function in the context of host-microbe interactions?

Animal models provide crucial insights into membrane protein function in vivo:

Animal ModelAdvantagesApplications for BL0593 ResearchLimitations
Gnotobiotic miceControlled microbiomeStudy BL0593 without microbial interferenceLimited translational value
High-fat diet miceMetabolic challenge modelAssess metabolic impacts of BL0593Strain-specific responses
Humanized microbiome miceMore translationalHuman-relevant ecological contextComplex interactions
Knockout/transgenic miceSpecific pathway analysisHost receptor interactionsTechnical complexity

The high-fat diet (HFD) mouse model has proven effective for studying B. longum BCBL-583 functions, revealing impacts on cholesterol metabolism and inflammatory responses. This model demonstrated that B. longum administration reduced total cholesterol and LDL-cholesterol in the blood while modulating inflammatory cytokines . Similar approaches could isolate BL0593-specific functions.

How can researchers distinguish between the direct effects of BL0593 and secondary metabolic effects?

Differentiating direct and indirect effects requires sophisticated experimental designs:

  • Purified protein studies: Examining direct effects of isolated BL0593 on cellular systems.

  • Complementary mutants: Creating variants with specific functional domains altered or deleted.

  • Temporal analysis: Monitoring immediate versus delayed responses to distinguish primary effects.

  • Metabolic flux analysis: Tracing metabolite changes using isotope labeling to identify direct metabolic impacts.

  • Inducible expression systems: Controlling the timing of BL0593 expression to separate immediate effects.

In B. longum BCBL-583 research, correlation analysis revealed relationships between gut microbiota composition changes and cholesterol/immune responses, highlighting the complex interplay between direct bacterial effects and secondary ecological shifts .

What techniques are most effective for studying BL0593 interactions with other membrane components?

Membrane protein interactions require specialized approaches:

  • Crosslinking-mass spectrometry: Identify proximal proteins in native membranes.

  • Co-immunoprecipitation with mild detergents: Preserve membrane protein complexes.

  • Bacterial two-hybrid systems: Modified for membrane protein interactions.

  • FRET-based interaction assays: For real-time dynamics in living cells.

  • Native PAGE: Separate intact membrane protein complexes.

  • Reconstitution studies: Reconstruct minimal systems with defined components.

Research on B. longum BCBL-583 has identified important membrane functions including cholesterol reduction through cellular absorption and accumulation . While specific membrane protein interactions weren't detailed, the methodological approaches for membrane isolation and functional characterization provide valuable templates for BL0593 research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.