Recombinant Bifunctional lycopene cyclase/phytoene synthase (carRA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. Please specify your required tag type for prioritized development.
Synonyms
carRA; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-602
Protein Length
full length protein
Species
Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555)
Target Names
carRA
Target Protein Sequence
MLTYMEVHLYFTLPVLALLAFLYKPFFTTKDRFKYIFLCTVAFATASPWDNYIVYHKAWS YCPECVTAVIGYVPLEEYMFFIIMTLITVTFTSLTMRWTLPSFFIRPETPVFQSVCVRYI PIVGFLTIAAKAWASSIPDSHPFYGACILWYVCPVLALLWIGSGEYMLRRWKAVLFSIAV PTIFLCWVDQYAIARGTWDISRRTSTGIMVLPSLPLEEFLFFLLIDTVLVFASCATDRAH AIVHIYITPMNHNKVSTWYMDFFYLCWAFLQTDQALSGETLSDLDATWRILREASASFYT ASSVFSFEARQDLGVLYGFCRATDDLADNNDVSVPDRKKQLELVRGFVRQMFDSKHGHPD IDWTQYSGSIPDSFIAAFRSFTRLRDVLEIKAVEELLDGYTFDLEQREVKNEDDLVYYSA CVASSVGEMCTRVLMASEPGGNRTMLKWTVERARDMGLALQLTNIARDIVTDSKQLGRSY VPRDWLTSQESALLKAGKARELGDERLRQIALKMVYTADDLNLMASRAIDYLPPSSRCGV RAACNVYTAIGVSLHKANGYPDRAHLTKLERMKVTFRCVYGFRKGHQGVQGDRGKSQAFT VI
Uniprot No.

Target Background

Function
Recombinant Bifunctional lycopene cyclase/phytoene synthase (carRA) is a bifunctional enzyme catalyzing the conversion of geranylgeranyl diphosphate to phytoene (phytoene synthase activity) and lycopene to β-carotene via the intermediate γ-carotene (lycopene cyclase activity).
Protein Families
Lycopene beta-cyclase family; Phytoene/squalene synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is the carRA gene organized structurally?

The carRA gene has a distinctive structural organization with two separate functional domains. The gene and its neighboring gene, carB (responsible for phytoene dehydrogenase activity), are separated by 1,381 untranslated nucleotides and are divergently transcribed . Within the carRA gene itself, there are discrete domains for lycopene cyclase and phytoene synthase activities. The lycopene cyclase domain appears to have evolved from a gene duplication event from a common ancestor of fungi and Brevibacterium linens, while the phytoene synthase domain shares similarities with phytoene and squalene synthases found across many different organisms . This domain arrangement reflects the gene's evolutionary history and its specialized role in fungal carotenoid biosynthesis.

What phenotypic effects result from mutations in the carRA gene?

  • Mutations in the domain responsible for lycopene cyclase activity (known as carR mutations) result in a red phenotype due to the accumulation of lycopene, which cannot be converted to β-carotene .

  • Mutations in the domain responsible for phytoene synthase activity (known as carA mutations) result in a white phenotype because these mutants cannot accumulate significant amounts of carotenoids .

These color changes provide a convenient visual marker for functional studies of the carRA gene and have been instrumental in defining the gene's role through complementation and mapping studies .

What techniques can be used to verify the enzymatic functions of the carRA-encoded protein?

The enzymatic functions of the carRA-encoded protein can be verified through several complementary approaches:

Heterologous Expression Systems:

  • Fungal Transformation: The carRA gene can be introduced into Mucor circinelloides mutants lacking phytoene synthase and/or lycopene cyclase activities. Subsequent carotenoid analysis by HPLC or spectrophotometry can demonstrate functional complementation if β-carotene production is restored .

  • Bacterial Expression: Co-transformation of E. coli with the carRA cDNA and carotenoid structural genes from organisms like Erwinia uredovora allows for detection of newly formed carotenoids that wouldn't normally be present .

Molecular Verification:

  • Northern Blot Analysis: This technique confirms whether the carRA mRNA is fully transcribed in transformants .

  • RT-PCR: This method verifies the correct processing of the carRA messenger RNA in the host organism .

Biochemical Analysis:

  • Carotenoid Extraction and HPLC Analysis: The presence of β-carotene in previously deficient mutants provides direct evidence of functional complementation .

The combination of these approaches provides robust validation of both lycopene cyclase and phytoene synthase activities encoded by the carRA gene.

How effective are heterologous expression systems for studying carRA function?

The effectiveness of heterologous expression systems for studying carRA function varies significantly between host organisms:

In Mucor circinelloides:

  • Transformation with the Phycomyces carRA gene leads to correct expression, as confirmed by both Northern blot assays and RT-PCR .

  • Functional complementation is achieved in mutants altered at the phytoene synthase, lycopene cyclase, or both activities, resulting in the restoration of β-carotene production .

  • As a related fungal species, M. circinelloides appears to be an effective host for carRA expression and functional studies.

In Escherichia coli:

This differential efficiency highlights the importance of selecting appropriate expression systems for studying bifunctional enzymes like carRA and suggests potential species-specific factors that may influence enzyme activity.

What is known about the evolutionary history of the carRA gene?

The evolutionary history of the carRA gene reveals fascinating insights into the development of carotenoid biosynthesis pathways:

Domain Origins:

  • The lycopene cyclase domain of carRA appears to have originated from a gene duplication event of a common ancestral gene shared by fungi and the bacterium Brevibacterium linens .

  • The phytoene synthase domain shows significant similarity to phytoene and squalene synthases found across diverse organisms, suggesting conservation of this enzymatic function throughout evolution .

Regulatory Evolution:

  • While the enzymatic domains share similarities with other organisms, the regulatory functions of carRA appear to be specific to Phycomyces . This suggests that while enzymatic functions may be conserved, regulatory mechanisms can evolve more rapidly to adapt to specific ecological niches.

Comparative Analysis:
The bifunctional nature of carRA, with two distinct enzymatic activities encoded by a single gene, represents an interesting case of evolutionary economy. This arrangement differs from many other organisms where separate genes encode these functions, suggesting potential selective advantages to this gene architecture in certain fungal lineages.

Understanding the evolutionary history of carRA provides valuable context for studying similar bifunctional enzymes and offers insights into the diverse strategies organisms have evolved for carotenoid biosynthesis.

What interactions exist between carRA and other components of the carotenoid biosynthetic pathway?

Research has revealed several important interactions between carRA and other components of the carotenoid biosynthetic pathway:

Interaction with carB:

  • The carRA and carB genes are closely linked in the genome, separated by 1,381 untranslated nucleotides, and are divergently transcribed . This genomic organization suggests potential co-regulation.

  • The simultaneous presence of both carRA and carB gene products from Phycomyces significantly increases the efficiency of these enzymes, indicating a functional interaction mechanism .

Pathway Regulation:

Enzymatic Cascade:

  • As bifunctional enzyme, carRA catalyzes two sequential steps in the pathway: the synthesis of phytoene (via phytoene synthase activity) and the cyclization of lycopene to form β-carotene (via lycopene cyclase activity).

  • This arrangement potentially allows for efficient substrate channeling between enzymatic domains and coordinated regulation of these sequential reactions.

Understanding these interactions is crucial for comprehending the integrated functioning of the carotenoid biosynthetic pathway and may provide insights for metabolic engineering applications.

What are the optimal experimental design strategies for studying carRA function?

When designing experiments to study carRA function, researchers should consider several key strategies:

Selection of Appropriate Model Systems:

  • Fungal Systems: Related fungi like Mucor circinelloides offer effective platforms for functional complementation studies due to similar genetic backgrounds .

  • Bacterial Systems: While E. coli transformation shows lower efficiency for carRA function, it can be useful when co-expressing multiple pathway components .

Experimental Controls:

  • Mutant Selection: Utilize mutants specifically altered at the phytoene synthase, the lycopene cyclase, or both activities to precisely define which domain is being complemented .

  • Domain-Specific Studies: Design experiments that can distinguish between the two enzymatic activities encoded by carRA to avoid confounding results.

Data Collection and Analysis:

  • Experimental Budget Optimization: When designing quantitative studies of enzymatic activities, consider optimizing experimental budgets using statistical approaches like D-optimality to maximize information gain while minimizing resource expenditure .

  • Model Comparison: Use statistical criteria such as BIC (Bayesian Information Criterion) or adjusted R² to compare different experimental models and determine the most efficient approach .

Table 1: Comparative Efficiency of Expression Systems for carRA Study

Expression SystemTranscription EfficiencyFunctional ComplementationAdvantagesLimitations
Mucor circinelloidesHigh (confirmed by Northern blot)Effective (β-carotene production)Related fungal species, proper mRNA processingRequires fungal transformation protocols
Escherichia coliVariableLow (improved with carB co-expression)Rapid growth, easy transformationLow efficiency without carB co-expression

Incorporating these considerations into experimental design will help ensure robust and reproducible results in carRA research while optimizing resource utilization.

How can researchers address the challenges of studying bifunctional enzymes like carRA?

Studying bifunctional enzymes like carRA presents unique challenges that require specialized approaches:

Domain Dissection Strategies:

  • Site-Directed Mutagenesis: Create targeted mutations in specific domains to disrupt one enzymatic activity while preserving the other, allowing the study of each function independently.

  • Domain Swapping: Exchange domains with homologous enzymes from other organisms to investigate domain-specific functions and interactions.

Activity Differentiation:

  • Sequential Assays: Develop assay systems that can measure each enzymatic activity separately despite being encoded by the same protein.

  • Intermediate Analysis: Monitor the production and consumption of the intermediate metabolite (lycopene) to assess the relative efficiency of each domain.

Protein-Protein Interaction Studies:

  • Co-Immunoprecipitation: Investigate potential interactions between carRA and other pathway proteins like carB .

  • Two-Hybrid Systems: Screen for interaction partners that may influence the efficiency or regulation of carRA activities.

Data Integration Approaches:

  • Pathway Modeling: Develop mathematical models that account for the bifunctional nature of carRA and its impact on pathway flux.

  • Sparse Linear Models: Apply statistical techniques for optimizing experimental design when studying complex multi-function proteins .

By implementing these specialized approaches, researchers can overcome the inherent complexity of studying bifunctional enzymes and generate more nuanced insights into carRA function and regulation.

What are the potential applications of understanding carRA function in metabolic engineering?

Understanding the bifunctional nature of carRA opens several promising avenues for metabolic engineering applications:

Enhanced Carotenoid Production:

  • Knowledge of how carRA efficiently catalyzes two sequential steps in carotenoid biosynthesis could inform the design of optimized pathways for β-carotene production in heterologous hosts.

  • The interaction between carRA and carB products suggests that co-expression strategies could significantly enhance pathway efficiency .

Bifunctional Enzyme Design:

  • The natural bifunctional arrangement of carRA could serve as a template for designing synthetic bifunctional enzymes that improve metabolic flux through other pathways.

  • Understanding domain interactions within carRA might reveal principles for creating novel enzyme fusions with improved catalytic properties.

Pathway Regulation Engineering:

  • The regulatory functions of carRA in response to environmental stimuli provide insights for designing biosynthetic pathways with built-in regulatory mechanisms.

  • This could enable the development of smart production systems that adjust their output in response to specific environmental conditions.

Table 2: Potential Applications of carRA Research in Metabolic Engineering

Application AreaKey carRA FeaturePotential ImplementationExpected Benefits
Carotenoid productionBifunctional activityFusion of separate enzymes into single proteinImproved metabolic flux, reduced enzyme expression burden
Environmental sensingRegulatory responseIntegration of sensing domainsProduction systems responsive to environmental cues
Pathway optimizationDomain interaction with carBCo-expression of complementary enzymesEnhanced enzymatic efficiency through protein-protein interactions

These applications highlight how fundamental research on carRA contributes to both our understanding of natural metabolic systems and our ability to engineer improved biosynthetic pathways.

What key research questions about carRA remain to be addressed?

Despite significant advances in understanding carRA, several important research questions remain unresolved:

Structural Biology Questions:

  • What is the three-dimensional structure of the carRA protein, and how are the two catalytic domains spatially arranged?

  • How does the protein structure facilitate potential substrate channeling between the two enzymatic activities?

Regulatory Mechanisms:

Evolutionary Development:

  • What selective pressures drove the fusion of lycopene cyclase and phytoene synthase into a single gene in certain fungal lineages?

  • Are there intermediate evolutionary forms of these enzymes in other species that could illuminate the fusion process?

Interaction Dynamics:

  • What is the precise nature of the interaction between carRA and carB that enhances enzymatic efficiency?

  • Are there other protein partners that interact with carRA to modulate its function?

Methodological Advancement Needs:

  • How can experimental designs be optimized to study complex bifunctional enzymes like carRA while minimizing resource expenditure?

  • What new analytical techniques might better capture the dual functionality of carRA in real-time?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.