Recombinant Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aas; YPTB3042; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-718
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype I (strain IP32953)
Target Names
aas
Target Protein Sequence
MAYRLLRALFRGLFRVTIDGVTDQFKHEKLIITPNHVSFLDGALLALFLPIKPVFAVYTS ITDTWYMRWLKPYVDFVALDPTNPMAIKHLVRMVEQGRPVVIFPEGRITVTGSLMKIYDG AAFVAAKSGAAVVPIRLDGPEFTHFGRLQGVLKTRWFPKISIHVLPATTIPMPQAPRSRE RRVLAGEHLHTIMMAARMATVPRETLFEALLSAQTRYGRFKPCIEDVSFKEDSYQTLLKK TLGVSRILQRFTVPGEHVGMLLPNATITAAAIFGASLRGRIPALLNYTSGAKGLQSAIIA ASLKTIVTSRQFLEKGKLTHLPEQVNEVNWVYLEDLKDTVTLTDKLWILFHLCFPRRAML PQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTPRDRFMSSLPLFHAFG LTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAHPYDFAR VRYVVAGAEKLAESTKQIWQDKFGIRILEGYGVTECAPVVAINVPMAAKVNTVGRILPGM EARLINVPGIAQGGRLQLRGPNIMRGYLRVENPGVLEQPSAENAQGELDANWYDTGDIVT LDEQGFCAIRGRVKRFAKLAGEMVSLESVEQLAISLSPEGQHAAAAKTDSAKGEALVLFT TDSEITRERLIKAARENGVPELAVPRDIRVVKALPLLGSGKPDFVTLGKMAQDPEMSV
Uniprot No.

Target Background

Function

This bifunctional protein plays a critical role in lysophospholipid acylation. It catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate, requiring ATP and magnesium. Its physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a byproduct of transacylation reactions or phospholipase A1 degradation.

Database Links
Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Bifunctional protein aas?

Bifunctional protein aas is a recombinant protein derived from Yersinia enterocolitica serotype O:8/biotype 1B. Structurally, the protein typically contains an N-terminal tag and may also include a C-terminal tag, with tag configurations determined based on protein stability requirements . The protein is available in either lyophilized or liquid form depending on the manufacturing process.

Functionally, Bifunctional protein aas transfers fatty acids to the 1-position of glycerophospholipids via an enzyme-bound acyl-ACP intermediate in the presence of ATP and magnesium. Its physiological role focuses on regenerating phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), which forms through transacylation reactions or degradation by phospholipase A1 . This dual functionality positions it as a key enzyme in phospholipid metabolism pathways.

What expression systems are commonly used for producing Recombinant Bifunctional protein aas?

Multiple expression systems can be employed for producing Recombinant Bifunctional protein aas, each offering distinct advantages depending on experimental requirements:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modificationsStructural studies, biochemical characterization
YeastModerate yield, some post-translational modificationsMore complex than bacterial systemsStudies requiring eukaryotic modifications
BaculovirusHigher-quality modifications, proper foldingLower yield, higher costInteraction studies, complex formation analysis
Mammalian cellsMost authentic modificationsLowest yield, highest cost, time-consumingFunctional studies requiring native activity

When selecting an expression system, researchers must consider that while the host can significantly impact protein quality, the standard expression hosts include E. coli, yeast, baculovirus, or mammalian cell systems . The purification approach typically requires achieving ≥85% purity as determined by SDS-PAGE for functional studies .

How is protein purity assessed for Recombinant Bifunctional protein aas studies?

Ensuring appropriate purity of Recombinant Bifunctional protein aas is critical for experimental reproducibility and validity. Multiple complementary methods should be employed:

SDS-PAGE analysis represents the standard approach, with ≥85% purity generally considered acceptable for most functional studies . For more precise quantification, densitometry analysis of stained gels provides numerical purity values.

Size exclusion chromatography offers an orthogonal approach to assess protein homogeneity and detect aggregates or degradation products. Analysis using systems such as Superdex 200 columns allows researchers to separate proteins based on molecular size, with pure protein eluting in a single, symmetrical peak .

Mass spectrometry provides the highest resolution assessment, confirming both purity and molecular identity simultaneously. This approach can detect even minor contaminants and verify the expected molecular weight of the target protein.

For researchers studying enzyme kinetics or structure-function relationships, activity assays serve as functional purity assessments, ensuring the protein preparation contains catalytically competent enzyme.

What buffer conditions optimize Bifunctional protein aas stability?

Optimizing buffer conditions is essential for maintaining Bifunctional protein aas stability during purification and subsequent experiments. Based on established protocols for similar bifunctional proteins, researchers should consider:

pH optimization: Bifunctional proteins often exhibit pH-dependent stability profiles. For similar enzymes, buffers in the pH range of 6.8-8.0 have proven effective, with PIPES buffer (20 mM, pH 6.8) specifically mentioned for related bifunctional proteins .

Salt concentration: Including NaCl (typically 150-300 mM) helps prevent non-specific protein interactions and enhances stability . The ionic strength requirements may vary depending on the specific experimental application.

Protective additives: Incorporating glycerol (5%) serves as a cryoprotectant and stabilizing agent . For long-term storage, additional preservatives such as NaN₃ (1 mM) may be beneficial .

Chelating agents: Including EDTA (1 mM) helps prevent metal-catalyzed oxidation and proteolysis by chelating trace metal contaminants .

Researchers should systematically evaluate stability using thermal shift assays or activity retention measurements after incubation under various conditions to determine the optimal buffer formulation for their specific experimental requirements.

How is the enzymatic activity of Bifunctional protein aas measured?

Measuring the dual enzymatic activities of Bifunctional protein aas requires specialized assays that can quantify both functions effectively:

Acyltransferase Activity Assay:

  • Reaction mixture containing ATP, Mg²⁺, and radiolabeled or fluorescently-labeled fatty acid donors

  • Incubation with 2-acyl-GPE substrate under optimal temperature conditions

  • Extraction of lipids and separation by thin-layer chromatography or HPLC

  • Quantification of labeled phosphatidylethanolamine formation

ATP Consumption Assay:
Since the reaction requires ATP , a coupled enzymatic assay measuring ATP consumption provides an indirect but convenient readout:

  • ATP consumption is coupled to NADH oxidation through pyruvate kinase and lactate dehydrogenase

  • The decrease in NADH absorbance at 340 nm correlates with enzyme activity

  • This approach allows real-time continuous monitoring of reaction kinetics

For proper enzyme characterization, researchers should determine key kinetic parameters (Km, Vmax, kcat) by varying substrate concentrations systematically. Similar approaches have been employed for other bifunctional proteins, where enzyme kinetic performance revealed insights into protein functionality and disease mechanisms .

How does ATP binding modulate Bifunctional protein aas activity?

ATP binding and hydrolysis represent critical steps in the catalytic mechanism of Bifunctional protein aas, specifically in its function of transferring fatty acids to the 1-position via an enzyme-bound acyl-ACP intermediate . This ATP-dependent process fundamentally influences protein conformation and catalytic efficiency.

The mechanistic role of ATP likely involves:

  • Energy Provision: ATP hydrolysis provides the thermodynamic driving force for the formation of the high-energy acyl-ACP intermediate required for subsequent fatty acid transfer reactions.

  • Conformational Changes: Nucleotide binding induces structural rearrangements that properly position catalytic residues and substrate binding sites, optimizing the reaction geometry.

  • Magnesium Coordination: Mg²⁺ ions, required as cofactors , coordinate with ATP phosphates to neutralize negative charges and facilitate phosphoryl transfer.

To experimentally investigate ATP's modulatory effects, researchers should:

  • Conduct enzyme kinetics with varying ATP concentrations

  • Utilize non-hydrolyzable ATP analogs to distinguish binding from hydrolysis effects

  • Perform isothermal titration calorimetry to determine binding thermodynamics

  • Employ fluorescence spectroscopy to monitor conformational changes upon ATP binding

  • Analyze the effects of divalent cation concentration on ATP-dependent activity

Understanding this ATP dependency has significant implications for enzyme regulation and potential development of activity modulators for research applications.

What experimental approaches resolve contradictory findings in Bifunctional protein aas research?

Researchers encountering contradictory results in Bifunctional protein aas studies should implement a systematic troubleshooting approach focused on identifying variables that influence experimental outcomes:

Protein Preparation Standardization:

  • Evaluate the influence of different expression systems (E. coli, yeast, baculovirus, mammalian cells)

  • Compare purification strategies and their impact on specific activity

  • Assess the effect of different tag configurations on protein function

  • Implement rigorous quality control metrics for each preparation

Assay Condition Optimization:

  • Systematically vary buffer components, pH, temperature, and ionic strength

  • Determine the impact of different detergents or lipid compositions

  • Test multiple orthogonal activity assays to confirm findings

  • Investigate time-dependent changes in enzyme behavior

Structural and Biophysical Characterization:
The presence of recombinant protein variants with altered stability or catalytic parameters can significantly affect experimental outcomes. Studies with similar bifunctional proteins have shown that "enzyme kinetic performance (Km, Vmax and kcat) of the recombinant protein variants were compromised to a varying extent" . Therefore, researchers should:

  • Perform thermal stability assessments

  • Analyze oligomerization state through size exclusion chromatography

  • Conduct circular dichroism spectroscopy to verify secondary structure integrity

  • Use hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

By systematically addressing these variables, researchers can identify the sources of experimental variation and establish standardized approaches that yield consistent results.

How can site-directed mutagenesis elucidate the catalytic mechanism of Bifunctional protein aas?

Site-directed mutagenesis represents a powerful approach to dissect the catalytic mechanism of Bifunctional protein aas by precisely modifying amino acid residues involved in substrate binding and catalysis. This technique can reveal mechanistic details that are otherwise difficult to obtain.

Strategic Mutagenesis Approaches:

Target CategoryMutation StrategyExpected OutcomeAnalysis Method
Catalytic residuesAla substitution of conserved acidic/basic amino acidsLoss of specific activityDetailed enzyme kinetics
ATP binding siteMutation of predicted adenine-binding residuesAltered ATP affinityNucleotide binding assays
Fatty acid binding pocketConservative substitutions in hydrophobic regionsChanged substrate specificitySubstrate preference analysis
Domain interfaceAlteration of residues at domain boundariesDisrupted communication between functionsKinetic coupling experiments
Metal binding sitesMutation of predicted Mg²⁺ coordinating residuesAltered metal dependenceActivity vs. metal concentration

Experimental Design Considerations:

  • Generate a library of single-point mutants targeting predicted functional residues

  • Express and purify each variant using identical protocols

  • Perform comprehensive kinetic characterization (Km, kcat, substrate specificity)

  • Conduct stability assessments (thermal denaturation, proteolytic susceptibility)

  • Where possible, obtain structural information through crystallography or other methods

This approach, similar to that employed for studying variants of other bifunctional proteins , enables researchers to establish structure-function relationships and elucidate catalytic mechanisms at the molecular level.

What techniques overcome challenges in crystallizing Bifunctional protein aas for structural studies?

Obtaining high-resolution structural information for Bifunctional protein aas presents significant challenges due to its dual functionality and potential conformational flexibility. Researchers should implement specialized approaches to overcome these obstacles:

Protein Engineering Strategies:

  • Design truncated constructs focusing on individual domains to reduce conformational heterogeneity

  • Introduce surface entropy reduction mutations (replacing high-entropy residues like Lys/Glu with Ala)

  • Create fusion constructs with crystallization chaperones (T4 lysozyme, BRIL, etc.)

  • Remove flexible regions identified through limited proteolysis or hydrogen-deuterium exchange

Crystallization Condition Optimization:

  • Implement high-throughput screening across thousands of conditions

  • Explore co-crystallization with substrates, products, or inhibitors to stabilize active conformation

  • Test various precipitants, additives, and nucleation techniques

  • Experiment with lipid cubic phase crystallization if membrane association is relevant

Alternative Approaches When Crystallization Fails: When traditional crystallization proves challenging, consider:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.