Recombinant Biofilm PGA synthesis protein PgaD (pgaD)

Shipped with Ice Packs
In Stock

Description

Function and Biosynthesis

PgaD is necessary for PGA formation . Specifically, PgaD interacts with PgaC, a glycosyltransferase required for PGA synthesis, and this interaction is enhanced by bis-(3'-5')-cyclic dimeric GMP (c-di-GMP) . In bacterial strains where c-di-GMP synthesis is compromised, the stability of PgaD is reduced, leading to deficient biofilm formation .

Regulation by c-di-GMP

Cyclic di-GMP (c-di-GMP) plays a vital role in regulating PgaD. It directly binds to both PgaC and PgaD, stimulating their glycosyltransferase activity . This binding stabilizes the interaction between the two proteins and promotes enzyme activity . At low c-di-GMP concentrations, PgaD cannot effectively interact with PgaC, leading to rapid degradation of PgaD and inactivation of the Pga machinery .

Role of PgaC in Stabilizing PgaD

PgaC is essential for the stability of PgaD. PgaD levels are significantly reduced in a ΔpgaC mutant but can be restored in a c-di-GMP-dependent manner when pgaC is expressed in trans . This indicates that PgaC protein, but not necessarily its glycosyltransferase activity, is required to stabilize PgaD .

PgaA and PgaB in PGA Export

While PgaC and PgaD are essential for PGA synthesis, PgaA and PgaB are involved in PGA export . Deletion of genes for the predicted outer membrane proteins PgaA and PgaB does not prevent PGA synthesis but blocks its export .

Post-translational Control

PgaC and c-di-GMP together control PgaD levels post-translationally . Protein stability assays have shown that PgaD remains stable over time in strains with normal or increased c-di-GMP levels, but it is rapidly degraded in strains with low cellular c-di-GMP concentrations .

Interaction Studies

In vivo and in vitro studies have confirmed the robust interaction between PgaC and PgaD . The interaction is stimulated by the ectopic expression of the heterologous DGC dgcA and weakened upon deletion of ydeH, which encodes a diguanylate cyclase that synthesizes c-di-GMP .

Mutations Affecting Biofilm Formation

Genetic mutation screens have identified mutants of pgaC and pgaD that confer biofilm formation in bacteria that cannot synthesize c-di-GMP . These mutations result in a form of PgaD that is stable even in the absence of c-di-GMP or stabilize PgaD through mutations in PgaC .

Impact on Biofilm Architecture

PGA influences the cellular architecture of E. coli biofilms, aiding the transition from temporary polar cell surface attachment to permanent lateral attachment during initial biofilm development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specifications.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
pgaD; Z1523; ECs1267; Biofilm PGA synthesis protein PgaD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
pgaD
Target Protein Sequence
MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLL AVANAVVLIVWALYNKLRFQKQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFT SQGQIKMVVSEKALVRA
Uniprot No.

Target Background

Function
Essential for the synthesis of poly-β-1,6-N-acetyl-D-glucosamine (PGA), a biofilm adhesin polysaccharide. It may facilitate the polymerization of PGA by the glycosyltransferase PgaC.
Database Links

KEGG: ece:Z1523

STRING: 155864.Z1523

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is PgaD and what role does it play in bacterial biofilm formation?

PgaD is a small membrane protein that forms part of the pgaABCD locus in Escherichia coli and other bacteria. This protein plays a critical role in biofilm formation by facilitating the synthesis of poly-β-1,6-N-acetyl-d-glucosamine (PGA), a key exopolysaccharide adhesin that promotes both initial surface attachment and subsequent intercellular adhesion during biofilm development . PgaD contributes to biofilm structural integrity by assisting in the production of this exopolysaccharide component of the biofilm matrix.

The protein contains two predicted transmembrane helices and functions primarily as an assistant to the glycosyltransferase PgaC in polymerizing PGA . Studies have demonstrated that deletion of pgaD results in significantly decreased biofilm formation capacity and reduced extracellular polysaccharide production, highlighting its essential nature in the biofilm formation process .

How does PgaD interact with other proteins in the pgaABCD operon?

PgaD forms a functional complex with PgaC, the inner membrane glycosyltransferase component of the PGA synthesis machinery . This interaction is critical for enzymatic activity, as neither protein alone is sufficient for PGA synthesis. Experimental evidence demonstrates that UDP-GlcNAc (the precursor for PGA) is only turned over to poly-GlcNAc when both PgaC and PgaD are expressed together .

The complete PGA synthesis and export machinery involves all four proteins encoded by the pgaABCD operon, each serving distinct functions:

  • PgaA: An outer membrane protein that forms a β-barrel structure facilitating PGA export

  • PgaB: A periplasmic protein with N-deacetylase activity that modifies the PGA polymer

  • PgaC: An inner membrane glycosyltransferase that synthesizes the PGA polymer

  • PgaD: The inner membrane assistant protein that stabilizes PgaC and enhances its activity

What experimental approaches can confirm PgaD's presence and function in bacterial cells?

Several methodological approaches can be used to detect and confirm PgaD expression and function:

  • Immunoblot analysis: Western blotting with PgaD-specific antibodies can detect the presence of the protein in bacterial cell lysates. Researchers have observed that PgaD protein levels correlate with c-di-GMP concentrations in the cell .

  • Phenotypic biofilm assays: Crystal violet staining provides a semi-quantitative method to assess biofilm formation capacity, which is significantly reduced in pgaD deletion mutants .

  • Congo red binding assays: Congo red-broth agar plates can be used to visualize differences in exopolysaccharide production between wild-type and pgaD mutant strains .

  • Extracellular polysaccharide quantification: The phenol-sulfuric acid method can quantitatively measure PGA production differences between strains with and without functional PgaD .

How does cyclic di-GMP regulate PgaD activity and stability?

Cyclic di-GMP (c-di-GMP) serves as a critical allosteric regulator of the PgaCD complex through a novel mechanism involving protein-protein interaction . Research has demonstrated that:

  • C-di-GMP binds directly to both PgaC and PgaD, the two inner membrane components of the PGA synthesis machinery.

  • This binding stabilizes the interaction between PgaC and PgaD, promoting the formation of an active glycosyltransferase complex.

  • At low c-di-GMP concentrations, PgaD fails to interact effectively with PgaC and is rapidly degraded, providing a mechanism to shut off PGA synthesis when c-di-GMP levels are low .

This regulatory mechanism represents the first example of a c-di-GMP-mediated process that relies on protein-protein interaction. Experiments have shown that YdeH, a diguanylate cyclase that produces c-di-GMP, strongly stimulates poly-GlcNAc-dependent biofilm formation. When YdeH and six other diguanylate cyclases were deleted, resulting in reduced cellular c-di-GMP levels, biofilm formation was severely impaired and PgaD protein became undetectable .

What is the molecular basis for PgaD degradation in the absence of c-di-GMP?

In the absence of c-di-GMP, PgaD fails to interact with PgaC and becomes susceptible to rapid degradation . This degradation mechanism serves an important regulatory function:

  • It facilitates the irreversible inactivation of the PGA synthesis machinery during periods of low c-di-GMP.

  • This temporarily uncouples PGA synthesis from c-di-GMP signaling in the absence of de novo synthesis of Pga components.

Interestingly, when PgaC and PgaD were expressed as a fusion protein (PgaCDf), the fusion remained stable even at low c-di-GMP concentrations, further supporting the hypothesis that PgaD instability at low c-di-GMP levels results from weak protein interactions rather than being the primary mechanism of PGA control .

What structural features of PgaD are essential for its function?

While the complete crystal structure of PgaD has not been reported in the provided search results, functional studies indicate several important features:

  • Transmembrane domains: PgaD is predicted to contain two transmembrane helices that anchor it in the inner membrane .

  • C-di-GMP binding site: PgaD contains a region capable of binding c-di-GMP, which is essential for its stability and interaction with PgaC .

  • PgaC interaction interface: Specific regions of PgaD are required for its productive interaction with PgaC to form an active glycosyltransferase complex.

Bacterial two-hybrid (BacTH) assays have been used to demonstrate the interaction between PgaC and PgaD, confirming that this interaction is enhanced by c-di-GMP .

How can recombinant PgaD be effectively expressed and purified for in vitro studies?

Expressing and purifying membrane proteins like PgaD presents significant challenges. Based on the research approaches described in the literature, the following methodology is recommended:

  • Expression system selection: E. coli expression systems with tightly controlled inducible promoters are typically used. Consider using E. coli strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3).

  • Fusion tags: N- or C-terminal tags (His6, MBP, or GST) can facilitate purification while minimizing impact on protein function. The location of the tag should be carefully considered to avoid disrupting transmembrane domains.

  • Membrane extraction: Gentle detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin are preferable for extracting PgaD from membranes while maintaining native conformation and activity.

  • Co-expression with PgaC: Since PgaD forms a functional complex with PgaC, co-expression of both proteins may enhance stability and solubility.

  • Activity verification: Following purification, in vitro activity assays should be performed to confirm that the recombinant protein retains functional properties.

What assays can measure PgaCD-dependent glycosyltransferase activity in vitro?

Several methodological approaches have been developed to assess PgaCD glycosyltransferase activity:

  • Membrane-based activity assay: An in vitro activity assay using membranes containing PgaCD can indirectly measure glycosyltransferase activity. This can be achieved through:

    • A modified enzyme-coupled spectrophotometric assay that monitors UDP release

    • Direct measurement of UDP-GlcNAc consumption

  • Reaction product visualization: Following incubation of active membranes with substrate for several hours, the slimy and viscous reaction product (PGA) can be visualized by light microscopy .

  • Immunological confirmation: Immunoblot analysis with anti-poly-GlcNAc antibodies can confirm the identity of the reaction product .

How can researchers effectively create and validate pgaD deletion and complementation strains?

Creating pgaD deletion and complementation strains is essential for studying its function. The following methodology has been successfully implemented:

  • Gene deletion approach:

    • The Lambda Red recombination system can be used to create pgaD deletions

    • Helper plasmid pKD46 is transferred into competent cells (e.g., E. coli MG1655)

    • Targeting fragments of the pgaD gene are transformed into competent cells to construct gene deletion mutants

  • Complementation strategy:

    • Using plasmids such as pBR322 as vectors

    • Cloning the pgaD gene into the vector

    • Transforming the recombinant plasmid into the pgaD deletion strain

  • Validation methods:

    • Congo red-broth agar plate assays to detect changes in biofilm properties

    • Crystal violet semi-quantitative method to measure biofilm formation capacity

    • Transmission electron microscopy to examine cellular morphology

    • Phenol-sulfuric acid method to quantify extracellular polysaccharide production

How does PgaD-dependent PGA synthesis contribute to biofilm architecture?

PgaD-dependent PGA synthesis plays multiple critical roles in biofilm architecture:

  • Initial surface attachment: PGA promotes the adhesion of bacteria to abiotic surfaces, enabling the first step of biofilm formation .

  • Intercellular adhesion: As a key exopolysaccharide adhesin, PGA mediates cell-to-cell attachment, which is essential for microcolony formation and biofilm maturation .

  • Structural integrity: PGA forms part of the extracellular matrix that encloses the biofilm and provides structural stability. When biofilms are treated with metaperiodate (which cleaves polysaccharides like PGA), they disperse, releasing intact cells, whereas protease treatment has no effect. This confirms PGA's role as a cohesive element in biofilm structure .

  • Protective barrier: The PGA component of the biofilm matrix may provide protection against biocides and immune killing in various bacterial pathogens .

What is the relationship between c-di-GMP signaling, PgaD activity, and biofilm development?

The relationship between c-di-GMP signaling, PgaD activity, and biofilm development represents a sophisticated regulatory network:

  • c-di-GMP as a master regulator: Cellular c-di-GMP levels serve as a master signal that determines whether bacteria adopt a planktonic or biofilm lifestyle.

  • YdeH as a key diguanylate cyclase: The YdeH enzyme produces c-di-GMP and has been shown to strongly stimulate poly-GlcNAc-dependent biofilm formation. In strains with multiple diguanylate cyclase deletions, biofilm formation is severely impaired, but can be restored by reintroducing only ydeH .

  • Allosteric activation: c-di-GMP binds to both PgaC and PgaD, promoting their interaction and stimulating glycosyltransferase activity. This allosteric mechanism represents a novel type of c-di-GMP receptor where ligand binding to two proteins stabilizes their interaction and promotes enzyme activity .

  • Coupled regulation: The expression of YdeH (diguanylate cyclase) and the Pga machinery is coordinated via the CsrA regulatory system, ensuring that c-di-GMP production and PGA synthesis are coupled .

Is PgaD conserved across bacterial species, and what does this tell us about its evolutionary significance?

The pgaABCD operon exhibits features of a horizontally transferred locus and is present in a variety of eubacteria, suggesting evolutionary significance in bacterial adaptation . The conservation of PgaD across diverse bacterial species indicates its fundamental importance in biofilm formation.

PGA (partially de-N-acetylated poly-β-1,6-N-acetyl-d-glucosamine) exopolysaccharides are required for biofilm structural stability in numerous human pathogens, including:

  • Yersinia pestis

  • Staphylococcus epidermidis

  • Burkholderia species

  • Acinetobacter baumannii

  • Aggregatibacter species

  • Klebsiella pneumoniae

  • Pathogenic Escherichia coli strains

This widespread conservation suggests that PGA synthesis through the pgaABCD system represents an ancient and successful strategy for bacterial adaptation to surface-attached lifestyles, which may provide protection against environmental stresses, biocides, and immune killing .

What are the primary obstacles in studying membrane proteins like PgaD?

Membrane proteins like PgaD present several technical challenges:

  • Expression and solubilization difficulties: Membrane proteins often express poorly in recombinant systems and require detergents for solubilization, which can affect protein folding and function.

  • Protein instability: PgaD is rapidly degraded at low c-di-GMP concentrations, making it difficult to isolate and study under certain conditions .

  • Functional complex formation: PgaD functions as part of a complex with PgaC, necessitating co-expression or reconstitution approaches to study its native activity .

  • Structural analysis limitations: The transmembrane nature of PgaD makes it challenging to obtain high-resolution structural information through conventional techniques like X-ray crystallography.

How can researchers effectively detect and quantify PgaD-dependent polysaccharide synthesis?

Several methodological approaches can overcome the challenges in detecting PgaD-dependent polysaccharide synthesis:

  • In vitro glycosyltransferase assays: Using membrane preparations containing both PgaC and PgaD to measure UDP-GlcNAc consumption or UDP release as indicators of enzymatic activity .

  • Immunological detection: Using antibodies specific to poly-GlcNAc to detect and quantify the PGA polymer in both cellular and in vitro settings .

  • Microscopic visualization: Light microscopy can be used to visualize the slimy, viscous reaction product following incubation of active membranes with substrate .

  • Biofilm quantification assays: Crystal violet staining provides a semi-quantitative method to assess biofilm formation capacity, which correlates with PgaD activity .

  • Phenol-sulfuric acid method: This colorimetric assay can be used to quantify extracellular polysaccharide production as a function of PgaD activity .

What approaches can distinguish the specific contribution of PgaD from other Pga proteins?

Differentiating PgaD's specific contribution from other Pga proteins requires careful experimental design:

  • Genetic complementation studies: Creating deletion mutants for each pga gene and then complementing them individually allows researchers to determine the specific contribution of each protein. For example, complementing a pgaABCD deletion with only pgaD can reveal which aspects of biofilm formation are specifically dependent on PgaD .

  • Protein fusion experiments: Creating a PgaCD fusion protein (PgaCDf) can help stabilize PgaD and allow researchers to study its function without the confounding effect of protein degradation at low c-di-GMP levels .

  • Bacterial two-hybrid assays: These can specifically detect interactions between PgaD and other proteins, revealing its role in complex formation .

  • Targeted mutations: Introducing specific mutations in the c-di-GMP binding site of PgaD can help distinguish between its structural role in the complex and its regulatory function in response to c-di-GMP signaling.

Through these methodological approaches, researchers can continue to elucidate the specific contributions of PgaD to biofilm formation and develop strategies to target this process for potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.