Recombinant Biopolymer transport protein exbB (exbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
exbB; STY3332; t3079; Biopolymer transport protein ExbB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Salmonella typhi
Target Names
exbB
Target Protein Sequence
MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKRRLKREQL QLADARSLDQASDIAAGFSAKSLSAQLINEAQNELELSQGSEDNEGIKERTGFRLERRVA AVGRYMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLA TAIGLVAAIPAVVIYNIFARQIGSYKATLGDVAAQVLLLQSRDLDLNASASAQPVRAAQK LRVG
Uniprot No.

Target Background

Function
ExbB is involved in TonB-dependent, energy-transducing transport of various receptor-bound substrates. It protects ExbD from proteolytic degradation and functionally stabilizes TonB.
Database Links

KEGG: stt:t3079

STRING: 220341.STY3332

Protein Families
ExbB/TolQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ExbB protein and what is its primary function?

ExbB is a cytoplasmic membrane protein that associates with ExbD and TonB to convey the energy of the proton-motive force to outer membrane receptors in Gram-negative bacteria. This energy transduction enables the import of essential nutrients, particularly iron, which would otherwise be unable to pass through the outer membrane . The ExbB protein forms a pentameric structure with a central pore where the ExbD dimer resides, collectively functioning as a molecular motor that harvests energy from the proton motive force across the cytoplasmic membrane . This complex is essential for various TonB-dependent transport processes, including the uptake of iron-siderophore complexes, vitamin B12, and certain bacteriocins .

How does the structure of ExbB vary across bacterial species?

The size of ExbB varies considerably across different species of Gram-negative bacteria . Most notably, ExbB in Serratia marcescens (Sm) possesses a long periplasmic extension that is absent in other bacteria such as Escherichia coli (Ec) . This extension interacts with HasB (a heme-specific TonB paralog) and is involved in heme acquisition . ExbB typically starts with its N-terminus in the periplasm, followed by three short transmembrane segments . The structural diversity of ExbB across bacterial species suggests evolutionary adaptations to specific nutrient acquisition strategies, particularly in organisms that possess additional TonB-like proteins such as HasB .

What is known about the genetic organization of ExbB?

The exbB gene is part of the exb locus, which contains two open reading frames: exbB and exbD . In E. coli, the exbB gene encodes a polypeptide of 244 amino acids, while exbD encodes a polypeptide of 141 amino acids . These genes show significant homology to the tolQ and tolR genes, respectively, with nucleotide sequence homology of 51.2% between exbB and tolQ and 49.7% between exbD and tolR . This genetic similarity suggests that both systems originated from a common evolutionary ancestor that catalyzed the uptake of substances too large to diffuse through the water-filled pores of the outer membrane .

How do mutations in ExbB affect bacterial iron acquisition pathways?

Mutations in the exbB gene significantly impair outer membrane receptor-dependent uptake processes in bacteria . Specifically, E. coli strains with exbB mutations exhibit resistance to the antibiotic albomycin and reduced sensitivity to group B colicins . These mutants are also defective in iron acquisition, evidenced by their inability to properly import ferrichrome . In experimental studies, radiolabeled ferrichrome taken up into an exbB mutant was shown to be chased out of cells, while ferrichrome that entered the cytoplasm of wild-type cells remained internalized .

When investigating iron acquisition pathways in exbB mutants, researchers should employ complementation experiments with plasmids carrying wild-type exbB, exbD, or exbBD to restore phenotypes. Additionally, the use of radioisotope-labeled siderophores combined with transport assays can quantitatively assess the impact of specific mutations on transport efficiency .

What are the structural and molecular determinants for the interaction between ExbB and other complex components?

The cryo-EM structures of ExbB and the ExbB-ExbD complex have revealed critical insights into their interactions . ExbB forms a stable pentameric structure with a central pore where two ExbD monomers reside . Key structural determinants include:

  • The transmembrane domains of ExbB, which contain residues essential for function and likely involved in interactions with TonB/HasB

  • The periplasmic extension of ExbB in certain species like S. marcescens, which directly interacts with HasB

  • The conserved Asp residue at position 25 in the transmembrane segment of ExbD, which is critical for proton translocation across the cytoplasmic membrane and essential for all TonB-dependent reactions

Investigating these interactions requires sophisticated structural biology approaches, including:

  • Cross-linking experiments coupled with mass spectrometry to identify interaction sites

  • Site-directed mutagenesis of key residues followed by functional assays

  • Co-immunoprecipitation experiments to validate protein-protein interactions in vivo

  • Advanced imaging techniques such as FRET to monitor dynamic interactions in living cells

How does the ExbB-ExbD complex harvest energy from the proton motive force?

The ExbB-ExbD complex functions as a molecular motor that derives energy from the proton motive force (pmf) across the cytoplasmic membrane . The conserved Asp25 residue in ExbD's transmembrane segment plays a critical role in proton translocation . The current model suggests that:

  • Protons flow from the periplasm to the cytoplasm through a pathway formed by ExbB and ExbD

  • This proton flow induces conformational changes in the complex

  • These conformational changes are transmitted to TonB, energizing it

  • Energized TonB then interacts with TBDTs at the TonB box, triggering conformational changes that release bound nutrients and open a pore for nutrient passage

To study this energy harvesting mechanism, researchers should consider:

  • Creating point mutations in the proton translocation pathway, particularly at Asp25 of ExbD

  • Using proton gradient uncouplers to assess pmf-dependent functions

  • Developing in vitro reconstitution systems with purified components in liposomes to directly measure proton translocation

  • Employing real-time spectroscopic techniques to monitor conformational changes during energy transduction

What are the optimal conditions for expressing and purifying recombinant ExbB protein?

Successful expression and purification of recombinant ExbB requires careful consideration of several factors:

ParameterRecommended ConditionsNotes
Expression SystemE. coli BL21(DE3) or C43(DE3)C43(DE3) is preferred for membrane proteins
Induction0.1-0.5 mM IPTG at OD600 0.6-0.8Lower temperatures (16-25°C) improve folding
Buffer Composition50 mM Tris-HCl pH 8.0, 300 mM NaCl, 5% glycerolAddition of 0.03-0.1% detergent critical for solubilization
DetergentsDDM, LDAO, or C12E8Must be above critical micelle concentration
Purification MethodIMAC followed by size exclusion chromatographyTag position affects oligomerization
Storage50 mM Tris-based buffer with 50% glycerol at -20°CFor extended storage, use -80°C

When working with recombinant ExbB, researchers should be aware that the protein forms pentamers and tends to associate with ExbD when co-expressed . To obtain pure ExbB pentamers, expression of ExbB alone is recommended, followed by rigorous purification steps to remove any co-purifying endogenous proteins. Additionally, the choice of affinity tag and its position (N- or C-terminal) can significantly impact protein function and oligomerization state .

What techniques are most effective for studying ExbB-ExbD-TonB interactions?

Several complementary techniques provide valuable insights into ExbB-ExbD-TonB interactions:

  • Affinity Co-purification: ExbB with a C-terminal (His)6 tag can be used to capture interacting partners like ExbD and TonB on Ni-NTA agarose columns . This approach has successfully demonstrated that ExbB physically binds to both ExbD and TonB, which can be co-eluted from the column .

  • Crosslinking Studies: Chemical crosslinking combined with mass spectrometry can identify specific residues involved in protein-protein interactions. This approach has been instrumental in developing structural models of the complex .

  • Cryo-Electron Microscopy: This technique has enabled determination of the structures of ExbB alone and the ExbB-ExbD complex, revealing critical structural insights .

  • Protein Stability Assays: ExbB physically stabilizes ExbD and TonB, and this can be assessed through proteolytic degradation experiments. For example, ExbB inhibits the degradation of ExbD by proteases in spheroplasts .

  • Functional Complementation: Testing the ability of recombinant proteins to restore sensitivity to colicins B and M and growth on iron siderophores in mutant strains provides functional validation of protein-protein interactions .

How can researchers effectively study the functional overlap between ExbB-ExbD and TolQ-TolR systems?

The partial functional overlap between the ExbB-ExbD and TolQ-TolR systems presents both challenges and opportunities for researchers. Effective strategies include:

  • Construction of Single and Multiple Mutants: Generate single exbB, exbD, tolQ, and tolR mutants, as well as double, triple, and quadruple mutants to assess the degree of functional redundancy .

  • Cross-Complementation Experiments: Test whether plasmids carrying wild-type exbB exbD can complement tolQ tolR mutations and vice versa .

  • Transport Assays: Measure the transport rates of substrates like cobalamin (vitamin B12) in various mutant backgrounds. For example, transport rates in an exbB mutant are approximately 20% of wild-type levels, 65% in a tolQ mutant, and <5% in an exbB tolQ double mutant or a tonB mutant .

  • Phage Infection Studies: Filamentous phages like fd require the Tol system for infection. Testing phage susceptibility in different mutant backgrounds provides insights into functional overlap .

  • Protein Localization Studies: Use fluorescent protein fusions or immunolocalization to determine whether the subcellular localization of these proteins changes in different mutant backgrounds.

What are the key experimental approaches for studying ExbB pentamer formation and stability?

The pentameric structure of ExbB is critical for its function . Key experimental approaches for studying pentamer formation and stability include:

TechniqueApplicationAdvantages
Size Exclusion ChromatographyAssess oligomeric state in solutionNon-destructive, can be performed under native conditions
Blue Native PAGEAnalyze intact membrane protein complexesMaintains physiological interactions, good resolution
Analytical UltracentrifugationDetermine stoichiometry and binding constantsProvides quantitative data on complex formation
Cryo-EMDetermine high-resolution structureReveals atomic details of pentamer architecture
Disulfide CrosslinkingProbe proximity of residuesCan be performed in vivo, confirms structural models
Hydrogen-Deuterium Exchange MSMap protein dynamics and interfacesIdentifies regions involved in oligomerization

The study of ExbB pentamer formation should include analysis of both wild-type and mutant proteins, particularly those with alterations in the transmembrane domains that are likely involved in oligomerization. Additionally, researchers should investigate how factors such as detergent choice, lipid composition, and pH affect pentamer stability, as these factors can significantly influence membrane protein oligomerization .

How can researchers effectively study the proton translocation mechanism of the ExbB-ExbD complex?

The proton translocation mechanism of the ExbB-ExbD complex is central to its energy transduction function. Effective experimental approaches include:

  • Site-Directed Mutagenesis: Target conserved charged residues, particularly the essential Asp25 in ExbD's transmembrane segment, and assess the impact on proton translocation and function .

  • pH-Sensitive Fluorescent Probes: Incorporate probes like pHluorin into specific locations within the complex to monitor local pH changes during proton translocation.

  • Proton Gradient Dissipation Experiments: Use protonophores like CCCP to dissipate the proton gradient and assess the impact on ExbB-ExbD-TonB function.

  • Liposome Reconstitution: Reconstitute purified ExbB-ExbD complexes into liposomes with controlled internal pH and measure proton flux across the membrane.

  • Electrophysiology: Apply patch-clamp techniques to proteoliposomes containing ExbB-ExbD to directly measure proton conductance.

  • Molecular Dynamics Simulations: Complement experimental approaches with computational models to predict proton pathways through the complex and the resulting conformational changes.

What experimental design considerations are important when investigating species-specific variations in ExbB structure and function?

The structural and functional variations of ExbB across different bacterial species, particularly the presence of periplasmic extensions in organisms like S. marcescens, require careful experimental design considerations:

  • Comparative Structural Analysis: Obtain high-resolution structures of ExbB from multiple species, with particular focus on regions showing significant sequence divergence .

  • Domain Swapping Experiments: Create chimeric proteins by swapping domains between ExbB variants from different species to identify functional determinants. For example, introduce the periplasmic extension from S. marcescens ExbB into E. coli ExbB to assess its effect on heme acquisition .

  • Correlation with Genomic Context: Analyze the presence of ExbB periplasmic extensions in relation to the presence of hasB genes across bacterial genomes. This correlation is observed in several genera of Alphaproteobacteria .

  • Functional Complementation Across Species: Test whether ExbB from one species can complement ExbB deficiency in another species, and identify the molecular determinants of any observed specificity.

  • Host-Specific Adaptation Studies: Investigate whether variations in ExbB structure correlate with host adaptation, particularly in pathogenic bacteria that must acquire iron within host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.