Recombinant Bison bison Sodium/potassium/calcium exchanger 1 (SLC24A1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
SLC24A1; NCKX1; Sodium/potassium/calcium exchanger 1; Na(+/K(+/Ca(2+-exchange protein 1; Retinal rod Na-Ca+K exchanger; Solute carrier family 24 member 1; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Bison bison (American bison) (Bos bison)
Target Names
SLC24A1
Target Protein Sequence
DPGSQGVGAEAENTGERTGGEAEAPAEGENGERSGGDAALGGESEGKAENESEGDIPAER RGDDEDEGEIQAEGGEVKGDEDEGEIQAGEGGEVEGDEDEGEIQAGEGGEVEGDEDEGEI QAGEGGEVEGDEDEGEIQAGEGGEVKDDEGEIQAGEAGEVEGEDGEVEGGEDEGEIQAGE GGEGETGEQELNAEIQGEAKDDEEGVDGEGGGDGGDSEDEEEEDEEEDEEEEEEEEEEEE EENEQPLSLEWPETRRKQAIYLFLLPIVFPLWLTVPDVRRLEAKKFFVITFLGSILWIAM
Uniprot No.

Target Background

Function

Function: A critical component of the visual transduction cascade, SLC24A1 (Sodium/potassium/calcium exchanger 1) regulates calcium concentration in the outer segments of retinal rod and cone photoreceptors during both light and dark conditions. Light exposure rapidly reduces cytosolic free calcium; this light-induced calcium reduction is facilitated by SLC24A1's extrusion activity, playing a key role in light adaptation. The protein transports 1 Ca2+ and 1 K+ ion in exchange for 4 Na+ ions.

Protein Families
Ca(2+):cation antiporter (CaCA) (TC 2.A.19) family, SLC24A subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is the structure of Bison bison SLC24A1 characterized at the molecular level?

Bison bison SLC24A1, like its mammalian counterparts, is characterized by a complex molecular structure that can be elucidated through various experimental approaches:

  • Domain organization: SLC24A1 contains approximately 10 transmembrane (TM) domains with a large cytoplasmic loop between TM domains 5 and 6 that plays a regulatory role .

  • Hydrophobic analysis: The protein contains membrane-spanning regions that can be identified through hydrophobicity plots.

  • Functional domains: The protein contains two Na+/Ca2+-K+ ion exchanger domains involved in binding and transport of physiologically important cations .

  • Alternative splicing: In rat models, SLC24A1 has been shown to have alternative splicing patterns in the central cytoplasmic domain, which may also be present in other mammalian species including Bison bison .

For characterization of recombinant Bison bison SLC24A1, researchers should employ a combination of approaches including mass spectrometry, circular dichroism spectroscopy, and X-ray crystallography to fully elucidate the structure-function relationship.

What expression systems are optimal for producing recombinant Bison bison SLC24A1?

For the successful expression of recombinant Bison bison SLC24A1, researchers should consider the following expression systems based on comparative studies with related proteins:

HEK-293 Cell System:
Human embryonic kidney cells (HEK-293) have been successfully used for the expression of rat eye NCKX1 and would likely be suitable for Bison bison SLC24A1 . The methodology involves:

  • Subcloning the SLC24A1 coding sequence into an appropriate expression vector (e.g., pCS2+ vector under the control of the CMV promoter)

  • Transfecting HEK293 cells using an appropriate transfection reagent (e.g., Gene-PORTER)

  • Harvesting cells 48 hours after transfection for protein purification or functional assays

Bacterial Expression Systems:
While prokaryotic systems offer high yield, the multiple transmembrane domains of SLC24A1 may lead to improper folding or insolubility. If attempting bacterial expression:

  • Use speciality strains designed for membrane proteins (e.g., C41(DE3), C43(DE3))

  • Optimize growth conditions (lower temperature, reduced IPTG concentration)

  • Consider fusion tags that enhance solubility (e.g., MBP, SUMO)

Insect Cell Systems:
For complex mammalian proteins like SLC24A1, baculovirus-infected insect cells may provide superior post-translational modifications:

  • Generate recombinant bacmid containing the SLC24A1 gene

  • Transfect insect cells (Sf9 or High Five™)

  • Harvest protein 72-96 hours post-infection

When selecting an expression system, researchers should consider the intended application of the recombinant protein, as each system offers different advantages for structural studies versus functional assays.

How can surface plasmon resonance (SPR) be optimized for studying Bison bison SLC24A1 interactions with regulatory proteins?

Surface plasmon resonance (SPR) offers a powerful tool for investigating protein-protein interactions involving recombinant Bison bison SLC24A1. Based on methodologies used for similar ion exchangers, researchers should consider the following optimized approach:

Protocol Optimization for SLC24A1 SPR Analysis:

Based on similar studies with other exchangers, researchers should expect binding affinities in the low nanomolar range (4-10 nM) for physiologically relevant interactions .

What are the methodological approaches for investigating calcium transport kinetics in recombinant Bison bison SLC24A1?

Investigating calcium transport kinetics of recombinant Bison bison SLC24A1 requires specialized approaches that measure ion exchange in real-time. The following methodological framework is recommended:

Calcium Uptake Assay Using Radioactive 45Ca2+:

This approach has been validated for sodium-calcium exchangers and can be adapted for Bison bison SLC24A1:

  • Express recombinant SLC24A1 in appropriate host cells (e.g., HEK293)

  • Harvest cells 48 hours post-transfection

  • Load cells with Na+ by incubating with buffer containing:

    • 10 mM Mops (pH 7.4)

    • 140 mM NaCl

    • 1 mM MgCl2

    • 0.4 mM ouabain

    • 25 μM nystatin for 10 minutes at room temperature

  • Initiate uptake by resuspending cells in:

    • 10 mM Mops (pH 7.4)

    • 140 mM KCl (or NaCl as control)

    • 25 μM CaCl2

    • 0.4 mM ouabain

    • 5 μCi/ml 45Ca2+ for 1 minute

  • Stop the reaction by adding quenching solution (140 mM KCl/1 mM EGTA)

  • Measure radioactivity by scintillation counting and normalize to total cellular protein

Calcium Imaging Using Fluorescent Indicators:

For direct visualization of calcium transport:

  • Load cells expressing SLC24A1 with calcium indicators (e.g., calcium green-1 dextran at 250 μM)

  • Image using confocal microscopy at high temporal resolution (≥30 Hz)

  • Analyze fluorescence intensity changes using appropriate software

  • Quantify kinetic parameters including:

    • Exchange rate (ions/second)

    • Affinity for calcium (Km)

    • Effects of membrane potential on transport activity

Electrophysiological Measurements:

For precise biophysical characterization:

  • Employ patch-clamp techniques in whole-cell or inside-out configuration

  • Use defined intracellular and extracellular solutions to isolate SLC24A1-mediated currents

  • Measure current-voltage relationships under varying ionic conditions

  • Determine stoichiometry through reversal potential measurements

These methodologies allow comprehensive characterization of the transport properties of recombinant Bison bison SLC24A1, providing insights into its physiological function.

How can mutations in recombinant Bison bison SLC24A1 be designed to study structure-function relationships?

Strategic mutation design is essential for elucidating structure-function relationships in recombinant Bison bison SLC24A1. Based on research with other mammalian SLC24A1 proteins, the following approaches are recommended:

Key Mutation Targets Based on Functional Domains:

  • Transmembrane Domains: Mutations in residues involved in ion coordination

  • Na+/Ca2+-K+ Exchanger Domains: Alterations in residues crucial for binding and transport of cations

  • Alternative Splicing Regions: Modifications in exons A-D of the central cytoplasmic domain that may affect regulation

Functional Analysis of Mutants:

After generating the mutant constructs, employ multiple assays to characterize functional changes:

  • SPR analysis to measure binding kinetics with regulatory partners

  • Calcium transport assays using radioactive 45Ca2+ uptake

  • Subcellular localization studies using immunofluorescence

  • Protein stability assessment through circular dichroism spectroscopy

Example Research Design Using Frame-Shift Mutation:

Based on the human c.1613_1614del mutation that causes CSNB, researchers could introduce an equivalent frameshift in Bison bison SLC24A1 to study functional consequences . This approach would:

  • Generate a premature termination codon

  • Potentially trigger nonsense-mediated decay

  • If protein is expressed, result in truncation of the second Na+/Ca2+-K+ exchanger domain

  • Allow assessment of partial function retention despite structural compromise

Through systematic mutation design and comprehensive functional characterization, researchers can develop detailed structure-function maps of Bison bison SLC24A1.

What statistical approaches are most appropriate for analyzing SLC24A1 functional data across species?

When analyzing functional data for recombinant Bison bison SLC24A1 in comparative studies with other species, researchers should implement robust statistical frameworks that account for both biological variability and experimental constraints:

Hierarchical Linear Modeling Approach:

For comparison of functional parameters (e.g., ion transport rates, binding affinities) across species:

  • Implement nested designs that account for both within-species and between-species variation

  • Use mixed-effects models with species as a random effect when comparing multiple parameters

  • Apply appropriate transformations (log, square root) to achieve normality when dealing with rate constants

Comparative Phylogenetic Methods:

When relating functional differences to evolutionary relationships:

  • Apply phylogenetically independent contrasts to control for shared ancestry

  • Use phylogenetic generalized least squares (PGLS) regression for continuous traits

  • Implement Bayesian approaches for ancestral state reconstruction of functional parameters

Experimental Design Considerations:

For optimal experimental power:

  • Conduct power analysis to determine required sample sizes for detecting cross-species differences

  • Use blocked designs to control for experimental batch effects

  • Consider adaptive experimental designs that optimize rollout of treatments as data is gathered about variability

Sample Size Determination Example:

For an experiment comparing calcium transport kinetics between Bison bison and Bos taurus SLC24A1:

  • Aim to detect differences of at least 20% in transport rate

  • Assuming a coefficient of variation of 15% based on prior studies

  • With α = 0.05 and β = 0.20 (80% power)

  • A minimum of 9 independent replicates per species would be required

By implementing these statistical approaches, researchers can make robust comparisons of SLC24A1 function across species while controlling for phylogenetic relationships and experimental variability.

How should researchers design experiments to resolve contradictory findings about SLC24A1 localization in different cell types?

Contradictory findings regarding SLC24A1 localization in different cell types require a comprehensive experimental design strategy to systematically resolve discrepancies. Based on previous research with SLC24A1, the following approach is recommended:

Multi-Method Validation Strategy:

Implement at least three independent localization methodologies:

  • Immunofluorescence/Immunohistochemistry:

    • Use multiple validated antibodies targeting different epitopes

    • Include appropriate positive and negative controls for each antibody

    • Apply super-resolution microscopy (STED, STORM) for precise subcellular localization

  • In Situ Hybridization:

    • Generate RNA probes of varying lengths (200-1200 bp) from cDNA clones

    • Use both sense and antisense probes as controls

    • Apply to 7μm cryosections following established protocols

  • Biochemical Fractionation:

    • Perform subcellular fractionation to isolate membrane compartments

    • Validate fraction purity with established markers

    • Confirm SLC24A1 presence by Western blotting

Expression System Comparison:

To address contradictions related to heterologous expression:

  • Compare localization in native tissue versus multiple expression systems

  • Test whether alternative splicing affects localization (as observed in rat NCKX1)

  • Assess whether fusion tags influence trafficking and localization

Developmental Timeline Analysis:

To resolve time-dependent localization differences:

  • Examine expression patterns across developmental stages (e.g., P01-P30)

  • Quantify transcript levels via qRT-PCR normalized against housekeeping genes

  • Compare with known development markers (e.g., rhodopsin for photoreceptor development)

Analytical Framework for Resolving Contradictions:

When differences are observed:

  • Determine if differences are cell-type specific or method-dependent

  • Evaluate whether expression level influences localization pattern

  • Consider whether alternative splice variants show different localization

  • Assess whether protein-protein interactions modify localization in specific contexts

By systematically implementing this experimental design, researchers can resolve contradictory findings about SLC24A1 localization across different cell types and expression systems.

What experimental controls are critical when comparing functional properties of native versus recombinant Bison bison SLC24A1?

Expression Level Controls:

  • Quantitative Western Blotting:

    • Use calibrated standards to determine absolute protein quantities

    • Compare expression levels between native and recombinant systems

    • Adjust functional data to account for expression differences

  • Surface Expression Quantification:

    • Implement cell-surface biotinylation assays

    • Use flow cytometry with non-permeabilized cells

    • Quantify functional protein versus total protein

Post-Translational Modification Controls:

  • Glycosylation Analysis:

    • Compare glycosylation patterns using specific glycosidases

    • Assess impact of glycosylation on function through enzymatic removal

    • Use mass spectrometry to identify specific modifications

  • Phosphorylation State:

    • Determine phosphorylation sites relevant to regulation

    • Compare phosphorylation state between native and recombinant protein

    • Assess functional consequences of phosphomimetic mutations

Structural Integrity Controls:

  • Limited Proteolysis:

    • Apply limited proteolysis to assess domain folding

    • Compare digestion patterns between native and recombinant proteins

    • Use circular dichroism to compare secondary structure profiles

  • Thermal Stability:

    • Perform thermal shift assays to compare stability

    • Assess aggregation propensity under physiological conditions

    • Measure activity retention after thermal stress

Functional Context Controls:

  • Lipid Environment:

    • Reconstitute recombinant protein in native-like lipid compositions

    • Test function in different membrane environments

    • Use native membrane extracts for comparative studies

  • Interacting Partners:

    • Identify key regulatory partners from native tissue

    • Test whether presence of these partners affects function

    • Assess binding affinities for regulatory molecules

Example Control Experiment Design:

For comparing calcium transport kinetics:

  • Extract native SLC24A1 from Bison bison retinal tissue

  • Express recombinant SLC24A1 in HEK293 cells

  • Normalize protein quantities through quantitative Western blotting

  • Compare transport rates using 45Ca2+ uptake assays under identical conditions

  • Assess effects of regulatory factors (e.g., calmodulin) on both preparations

  • Determine whether differences persist after accounting for all variables

By implementing this comprehensive control framework, researchers can confidently attribute functional differences to intrinsic properties rather than experimental artifacts.

How can recombinant Bison bison SLC24A1 be used to study evolutionary adaptations in visual systems?

Recombinant Bison bison SLC24A1 provides a valuable tool for studying evolutionary adaptations in mammalian visual systems. A comprehensive research framework should include:

Comparative Functional Analysis Across Species:

  • Transport Kinetics Comparison:

    • Express recombinant SLC24A1 from multiple species (Bison bison, Bos taurus, and other mammals)

    • Measure ion exchange rates under standardized conditions

    • Correlate functional differences with visual ecology (diurnal vs. nocturnal, predator vs. prey)

  • Temperature Sensitivity Profiling:

    • Assess function across temperature ranges relevant to species' habitats

    • Determine Q10 values (rate change per 10°C) for each ortholog

    • Identify adaptive mutations conferring thermal stability or flexibility

Structure-Function Relationship Mapping:

  • Generate chimeric proteins combining domains from Bison bison SLC24A1 with other species

  • Identify regions responsible for species-specific functional properties

  • Use site-directed mutagenesis to convert Bison-specific residues to those found in other species

Retinal Adaptation Model Development:

  • Create mathematical models of calcium homeostasis in different species' photoreceptors

  • Incorporate measured kinetic parameters from recombinant SLC24A1 proteins

  • Simulate photoreceptor response under various light conditions

Experimental Design for Evolutionary Studies:

A robust approach would include:

  • Selection of species representing diverse habitats and visual ecology

  • Cloning and expression of SLC24A1 orthologs from each species

  • Standardized functional characterization using calcium imaging and electrophysiology

  • Correlation of functional parameters with:

    • Visual ecology metrics

    • Habitat characteristics

    • Phylogenetic relationships

This research framework allows researchers to identify molecular adaptations in SLC24A1 that contribute to visual system evolution across mammalian species, with particular focus on adaptations specific to Bison bison.

What methodological approaches can be used to study the role of Bison bison SLC24A1 in retinal diseases?

To investigate the role of Bison bison SLC24A1 in retinal diseases, researchers can employ several methodological approaches that build on established knowledge of SLC24A1-associated pathologies in humans:

Disease-Associated Mutation Modeling:

  • Mutation Introduction Strategy:

    • Engineer Bison bison SLC24A1 constructs containing mutations analogous to those causing CSNB and retinitis pigmentosa in humans

    • Generate mutations including:

      • Frameshift mutations (e.g., equivalent to human c.1613_1614del)

      • Missense mutations affecting ion binding or transport

      • In-frame deletions (e.g., equivalent to human c.1691_1693del, p.(Phe564del))

    • Express mutant proteins in appropriate cell systems for functional characterization

  • Protein Modeling Analysis:

    • Use structural modeling to predict functional effects of mutations

    • Compare effects on transmembrane domains, especially those forming ion transport pathways

    • Assess disruption of protein-protein interaction interfaces

Cellular Disease Models:

  • Primary Retinal Cell Culture Systems:

    • Establish primary cultures from Bison bison retinal tissue

    • Knockdown endogenous SLC24A1 using siRNA/shRNA

    • Rescue with wild-type or mutant constructs

    • Assess cellular phenotypes:

      • Calcium homeostasis disruption

      • ER stress responses

      • Mitochondrial dysfunction

      • Apoptotic pathway activation

  • iPSC-Derived Retinal Organoid Models:

    • Generate iPSCs from Bison bison cells

    • Differentiate into 3D retinal organoids

    • Manipulate SLC24A1 expression using CRISPR/Cas9

    • Evaluate developmental and functional consequences

Functional Characterization of Disease Variants:

  • Calcium Imaging Protocols:

    • Load cells with calcium indicators and measure:

      • Basal calcium levels

      • Calcium clearance rates after stimulation

      • Response to retina-specific stimuli

  • Electrophysiological Assessment:

    • Record sodium-calcium exchange currents using patch-clamp techniques

    • Compare current amplitudes and kinetics between wild-type and mutant proteins

    • Assess effects of disease mutations on voltage sensitivity and ion specificity

Therapeutic Strategy Testing Platform:

  • Use disease models to evaluate:

    • Pharmacological chaperones for misfolded SLC24A1 variants

    • Alternative calcium regulators as compensatory mechanisms

    • Gene therapy approaches for selective expression of functional SLC24A1

This comprehensive methodological framework enables detailed investigation of how SLC24A1 mutations contribute to retinal diseases, potentially revealing conservation of disease mechanisms across species.

How can protein stability of recombinant Bison bison SLC24A1 be enhanced for structural studies?

Enhancing the stability of recombinant Bison bison SLC24A1 is crucial for successful structural studies, particularly given the challenges associated with membrane proteins. The following methodological approaches are recommended:

Construct Optimization Strategies:

  • Domain Engineering:

    • Remove flexible regions identified through limited proteolysis

    • Design constructs excluding the alternatively spliced regions (exons A-D) that may cause instability

    • Create fusion constructs with stability-enhancing partners (e.g., T4 lysozyme, BRIL)

  • Thermostability Improvement:

    • Implement consensus sequence-based mutations from thermophilic relatives

    • Introduce disulfide bonds at strategic positions based on structural modeling

    • Apply computational design algorithms (e.g., Rosetta) to identify stabilizing mutations

Expression Optimization Protocol:

  • Expression System Selection:

    • Test multiple systems (E. coli, yeast, insect cells, mammalian cells)

    • Optimize codon usage for the selected expression host

    • Consider cell-free systems for difficult-to-express constructs

  • Induction Conditions:

    • Employ low temperature expression (16-20°C) to improve folding

    • Test various induction regimes (concentration, timing, duration)

    • Utilize specialized media formulations to enhance membrane protein expression

Purification Strategy Development:

  • Detergent Screening Protocol:

    • Systematically evaluate detergents using a thermal stability assay:

      • Extract protein in initial detergent (e.g., DDM)

      • Exchange into test detergents

      • Measure thermal stability using CPM fluorescence assay

      • Rank detergents by Tm values and monodispersity

  • Lipid Supplementation:

    • Identify lipids critical for stability through lipidomics of native membranes

    • Supplement purification buffers with specific lipids

    • Consider reconstitution into nanodiscs or lipid cubic phase for structural studies

Stability Assessment Methods:

  • Size-Exclusion Chromatography:

    • Monitor monodispersity over time at different temperatures

    • Assess effects of additives on aggregation propensity

    • Compare elution profiles of wild-type and engineered variants

  • Thermal Stability Assays:

    • Track unfolding using differential scanning fluorimetry

    • Measure activity retention after thermal challenges

    • Develop high-throughput stability screens for mutant libraries

Example Optimization Workflow:

  • Generate multiple construct designs based on sequence analysis and structural prediction

  • Express in parallel in selected systems

  • Evaluate protein quality by SEC-MALS and thermal stability assays

  • Select top-performing constructs for scaled production

  • Optimize purification protocol through systematic detergent and additive screening

  • Validate final preparation by functional assays before structural studies

This comprehensive approach addresses the unique challenges of membrane protein stability and increases the likelihood of obtaining high-quality recombinant Bison bison SLC24A1 suitable for structural studies.

Comparative Expression Data for SLC24A1 Across Tissues and Species

The following table presents comparative expression data for SLC24A1 across different tissues and species, providing reference values for researchers working with Bison bison SLC24A1:

Tissue TypeHuman SLC24A1Mouse Slc24a1Rat Slc24a1Predicted Bison bison SLC24A1*
RetinaHigh (+++++)High (+++++)High (+++++)High (+++++)
Iris-ciliary bodyLow (+)Low (+)Low (+)Low (+)
Retinal pigment epitheliumLow (+)Low (+)Low (+)Low (+)
BrainVery low (+/-)Very low (+/-)Very low (+/-)Very low (+/-)
EsophagusLow (+)Low (+)Low (+)Low (+)
LungLow (+)Low (+)Low (+)Low (+)
ThymusLow (+)Low (+)Low (+)Low (+)
SpleenLow (+)Low (+)Low (+)Low (+)
AdrenalLow (+)Low (+)Low (+)Low (+)
CorneaNot detected (-)Not detected (-)Not detected (-)Not detected (-)
LensNot detected (-)Not detected (-)Not detected (-)Not detected (-)
Optic nerveNot detected (-)Not detected (-)Not detected (-)Not detected (-)

*Predicted based on phylogenetic relationship with bovine SLC24A1

This comparative expression table serves as a valuable reference for researchers working on tissue-specific expression of recombinant Bison bison SLC24A1 and guides appropriate experimental design.

The following table summarizes known mutations in SLC24A1 associated with retinal diseases, providing valuable reference for researchers studying Bison bison SLC24A1 disease models:

MutationProtein EffectDisease PhenotypeFunctional ImpactReference
c.1613_1614delp.F538CfsX23CSNB (Congenital Stationary Night Blindness)Frameshift resulting in premature termination; potential nonsense-mediated decay
c.1691_1693delp.Phe564delCSNBIn-frame deletion affecting transmembrane domain; milder functional effect
Multiple truncating mutationsPremature protein terminationRetinitis PigmentosaProgressive retinal degeneration; severe functional impairment
Missense mutations with severe functional effectsAmino acid substitutionsRetinitis PigmentosaDisruption of transport function; protein instability

This table provides a reference for researchers designing mutation studies in recombinant Bison bison SLC24A1 to investigate disease mechanisms and potential therapeutic approaches.

What emerging technologies will advance structural studies of Bison bison SLC24A1?

Several emerging technologies show particular promise for advancing structural studies of recombinant Bison bison SLC24A1:

Cryo-Electron Microscopy (Cryo-EM) Advancements:

Recent developments in cryo-EM technology offer unprecedented opportunities for membrane protein structural studies:

  • Single-particle analysis with direct electron detectors can achieve near-atomic resolution

  • Focused refinement techniques allow detailed visualization of flexible domains

  • Time-resolved cryo-EM enables capture of different conformational states during the transport cycle

Methodological Implementation:

  • Express and purify recombinant Bison bison SLC24A1 in stable detergent or nanodisc systems

  • Optimize grid preparation to minimize preferred orientation issues

  • Collect data using state-of-the-art microscopes with energy filters

  • Apply 3D classification to separate conformational states

  • Build atomic models based on high-resolution density maps

Integrative Structural Biology Approaches:

Combining multiple experimental techniques provides complementary structural information:

  • X-ray crystallography for high-resolution static structures

  • Small-angle X-ray scattering (SAXS) for solution state conformations

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for dynamics information

  • Cross-linking mass spectrometry (XL-MS) for proximity constraints

Advanced Computational Methods:

Computational approaches increasingly contribute to membrane protein structural studies:

  • AI-based structure prediction (AlphaFold2, RoseTTAFold) for model generation

  • Molecular dynamics simulations to study conformational dynamics

  • Enhanced sampling techniques to characterize ion permeation pathways

  • Machine learning approaches for model validation and refinement

Novel Expression and Stabilization Strategies:

Emerging techniques to improve membrane protein stability include:

  • Directed evolution approaches to identify stabilizing mutations

  • Designed ankyrin repeat proteins (DARPins) as crystallization chaperones

  • Conformational stabilization through engineered disulfide bonds

  • Lipid nanodisc and styrene maleic acid lipid particle (SMALP) technologies

These emerging technologies, when applied in combination, will significantly advance our structural understanding of Bison bison SLC24A1 and its conformational changes during the transport cycle.

How might computational approaches enhance our understanding of Bison bison SLC24A1 function?

Computational approaches offer powerful tools for understanding the complex function of Bison bison SLC24A1 at multiple scales:

Molecular Dynamics Simulations:

Advanced simulation techniques can reveal mechanistic details of ion transport:

  • All-atom MD simulations to characterize ion binding sites and permeation pathways

  • Enhanced sampling methods (metadynamics, umbrella sampling) to calculate energy barriers

  • Coarse-grained simulations to study protein-lipid interactions on longer timescales

Implementation Strategy:

  • Build homology model of Bison bison SLC24A1 based on available structures

  • Embed model in physiologically relevant lipid bilayer

  • Perform equilibrium and biased simulations to study conformational changes

  • Calculate ion binding free energies and selectivity determinants

Machine Learning Applications:

ML approaches can identify patterns in experimental data:

  • Deep learning models to predict effects of mutations on stability and function

  • Clustering algorithms to identify residue networks involved in allosteric regulation

  • Generative models to design optimized variants with enhanced properties

Systems Biology Modeling:

Multi-scale modeling connects molecular function to cellular physiology:

  • ODE-based models of calcium homeostasis incorporating SLC24A1 kinetics

  • Spatial models of calcium dynamics in photoreceptor outer segments

  • Integrative models connecting ion exchange to visual signal transduction

Evolutionary Sequence Analysis:

Computational phylogenetics reveals functional constraints:

  • Identification of conserved residues essential for function

  • Detection of co-evolving residue networks

  • Reconstruction of ancestral sequences to study evolutionary trajectories

By integrating these computational approaches with experimental data, researchers can develop a comprehensive understanding of Bison bison SLC24A1 function from the atomic to the cellular level, guiding experimental design and interpretation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.