Recombinant Bison bonasus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bison bonasus Cytochrome c Oxidase Subunit 2 (MT-CO2)

Recombinant Bison bonasus Cytochrome c oxidase subunit 2 (MT-CO2) is a specific protein that can be sourced from the European bison (Bison bonasus) . Cytochrome c oxidase subunit 2 (MT-CO2) is a component of the cytochrome c oxidase enzyme complex, which is essential for cellular respiration .

Basic Information

  • Chemical Name: Recombinant Bison bonasus Cytochrome c oxidase subunit 2 (MT-CO2)

  • CBNumber: CB615629001

  • Molecular Weight: 0

  • Molecular Formula: Data unavailable

Function and Relevance

Cytochrome c oxidase is a large transmembrane protein complex found in the mitochondria of eukaryotic cells and also in bacteria. It is the last enzyme in the respiratory electron transport chain of mitochondria, located in the mitochondrial inner membrane. It receives an electron from each of four cytochrome c molecules, and transfers them to one oxygen molecule, converting the molecular oxygen to two water molecules. In performing this reaction, the enzyme creates an electrochemical gradient across the inner mitochondrial membrane, which is used to generate chemical energy in the form of ATP. Subunit 2 (MT-CO2) is a vital part of this complex.

Research Applications

Although specific research findings directly focusing on the recombinant Bison bonasus Cytochrome c oxidase subunit 2 (MT-CO2) are not available, the broader context of bison rewilding and its ecological impact provides some relevance . Rewilding initiatives involving European bison have shown a positive impact on carbon sequestration in grasslands .

Bison Rewilding and Carbon Sequestration

Rewilding of European bison contributes significantly to carbon capture, helping to mitigate climate change . A group of 170 European bison in Romania’s Tarcu mountains helps to capture approximately an additional 54,000 tonnes of carbon per year, nearly 10 times more than without the Bison . This corresponds to the CO2 released by up to 84,000 average American petrol cars annually .

Data Table: Isotopic Analysis of Ancient Bison Bones and Teeth

The following data table shows the isotopic analysis of ancient bison bones and teeth :

BisonSample SiteSkeletal ComponentCal BP Date RangeMedian Age (cal BP)% Collagen% C% NC:Nδ 13C (‰ VPDB)δ 15N (‰ AIR)
1Medoramolar fragment270121124.445.016.33.2−17.4
2Mondrian Tree 32MZ58bone fragment3357324132914.546.916.03.4−21.1
3Mondrian Tree 32MZ58phalanx2724249725803.042.614.93.3−18.5
4Anton Rygh 39CA4metatarsal5013324696.342.915.13.3−14.8

Role of Bison in Ecosystems

European bison enhance carbon sequestration through several mechanisms :

  • Fertilizing grasses and dispersing seeds: Promotes plant growth and carbon absorption .

  • Compacting the soil: Increases the soil's capacity to retain carbon .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Bison bonasus (European bison)
Target Names
Target Protein Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme complex drives oxidative phosphorylation by facilitating electron transfer from reduced cytochrome c to molecular oxygen, generating a proton gradient across the inner mitochondrial membrane that powers ATP synthesis. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to oxygen. Within cytochrome c oxidase, electrons are transferred from cytochrome c via the Cu(A) center of subunit 2 and heme a of subunit 1 to the binuclear center (BNC), composed of heme a3 and Cu(B) in subunit 1. The BNC catalyzes the reduction of molecular oxygen to water, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what is its functional significance in mitochondrial processes?

Cytochrome c oxidase subunit 2 (MT-CO2) is one of the core subunits of mitochondrial Cytochrome c oxidase (Cco), which plays a crucial role in cellular respiration. MT-CO2 contains a dual core CuA active site that serves as the initial electron acceptor from cytochrome c in the electron transport chain . This subunit is particularly significant because it carries the metal center that initiates electron transfer from cytochrome c to the remaining metal centers in the cytochrome oxidase complex .

The functional importance of MT-CO2 extends beyond basic electron transfer, as it contains several conserved regions, including an aromatic region with five aromatic and three non-aromatic amino acids that are highly conserved across diverse organisms. This conservation suggests an essential role in maintaining the protein's electron transfer capabilities .

How is recombinant Bison bonasus MT-CO2 typically expressed in laboratory settings?

Recombinant Bison bonasus MT-CO2 is typically expressed in E. coli expression systems. The protein can be produced with an N-terminal His tag to facilitate purification . The expression process generally involves:

  • Subcloning the MT-CO2 gene into an appropriate expression vector (such as pET-32a)

  • Transforming the construct into a suitable E. coli strain (such as Transetta DE3)

  • Inducing protein expression using isopropyl β-d-thiogalactopyranoside (IPTG)

  • Purifying the recombinant protein using affinity chromatography with Ni²⁺-NTA agarose

The full-length protein comprises 227 amino acids with a predicted molecular mass of approximately 26.2 kDa, though the addition of tags will increase this size .

What storage conditions optimize the stability of recombinant MT-CO2?

For optimal stability of recombinant MT-CO2, the following storage conditions are recommended:

Storage ConditionRecommendation
Long-term storage-20°C/-80°C with 5-50% glycerol (50% is commonly used)
Working aliquots4°C for up to one week
Physical formLyophilized powder for maximum stability
BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL

It is advisable to centrifuge the vial briefly prior to opening to bring the contents to the bottom. Repeated freeze-thaw cycles should be avoided as they can decrease protein activity and stability .

How can sequence alignment and phylogenetic analysis be utilized to study MT-CO2 evolution?

Sequence alignment and phylogenetic analysis of MT-CO2 provide valuable insights into evolutionary relationships across species. When conducting such analyses:

  • Obtain complete sequence data for MT-CO2 from various species

  • Perform multiple sequence alignment to identify conserved regions and variations

  • Construct phylogenetic trees using appropriate methods (neighbor-joining is common but may not be optimal for complete sequence data)

  • Analyze branching patterns to infer evolutionary relationships

For mitochondrial DNA analysis including MT-CO2, it's important to recognize that recurrent mutations can occur in the coding region, which may complicate precise branching order determination in some cases. Additionally, rapid dispersals and expansions of populations in evolutionary history have created multifurcations in the phylogenetic tree that can be challenging to resolve even with whole mtDNA genome analysis .

What are the optimal conditions for assaying cytochrome c oxidase activity in recombinant MT-CO2?

When assaying cytochrome c oxidase activity in recombinant MT-CO2, researchers should consider the following methodological approach:

  • Preparation of recombinant protein:

    • Ensure tag-free protein if possible, or verify that the tag does not interfere with function

    • Maintain proper folding and structural integrity during purification

  • Assay conditions:

    • Use UV-spectrophotometry to monitor the oxidation of reduced cytochrome c

    • Track the decrease in absorbance at 550 nm as ferrocytochrome c is oxidized

    • Maintain physiological pH (typically 7.0-7.4) and temperature (typically 25-37°C)

  • Controls and validation:

    • Include known inhibitors as negative controls

    • Use commercial cytochrome c oxidase as a positive control

    • Test enzyme kinetics with varying substrate concentrations

Research has demonstrated that recombinant MT-CO2 can catalyze the oxidation of cytochrome c substrate, and this activity can be influenced by compounds such as allyl isothiocyanate (AITC) . Spectrophotometric and infrared spectrometer analyses are effective methods for measuring this catalytic activity.

How do amino acid substitutions in the conserved aromatic regions affect MT-CO2 function?

The conserved aromatic region in MT-CO2 has been postulated to be involved in the transfer of electrons from the copper center in subunit II to the remaining metal centers of cytochrome oxidase in subunit I . Research examining the functional importance of conserved aromatic residues has utilized site-directed mutagenesis to create specific amino acid substitutions.

When investigating the effects of such substitutions:

  • Select conserved residues based on sequence alignment across species

  • Design mutations that alter key properties (charge, size, hydrophobicity)

  • Express mutant proteins in suitable systems (yeast systems have been used successfully)

  • Evaluate functional consequences through multiple assays:

    • Cellular respiration capacity

    • Growth rates on non-fermentable carbon sources

    • Direct measurement of cytochrome c oxidase activity

For comprehensive analysis, researchers should consider combining biochemical assays with structural studies (X-ray crystallography or cryo-EM) to directly visualize how substitutions affect the three-dimensional arrangement of the electron transfer pathway.

What molecular docking approaches are effective for studying interactions between MT-CO2 and potential inhibitors or substrates?

Molecular docking provides valuable insights into substrate binding and inhibitor interactions with MT-CO2. An effective molecular docking methodology involves:

  • Preparation of protein structure:

    • Obtain high-resolution crystal structures or generate homology models

    • Prepare the protein by adding hydrogen atoms, assigning charge states, and removing non-essential water molecules

  • Ligand preparation:

    • Generate 3D structures of substrates or inhibitors

    • Create multiple conformers to account for flexibility

  • Docking procedure:

    • Define binding site based on known functional regions (the CuA site for substrate binding)

    • Employ flexible docking algorithms that allow side-chain movements

    • Use scoring functions that account for metal coordination

  • Analysis of results:

    • Examine hydrogen bonding patterns and other interactions

    • Calculate binding energies

    • Validate predictions experimentally

Research has successfully employed molecular docking to identify that allyl isothiocyanate (AITC) can interact with MT-CO2, forming a hydrogen bond between a sulfur atom in AITC and Leu-31 with a bond length of 2.9 Å . This approach can guide future research on site-directed mutagenesis by identifying key residues for experimental modification.

What are the challenges and solutions in expressing membrane-associated MT-CO2 in bacterial systems?

Expression of membrane-associated proteins like MT-CO2 in bacterial systems presents several challenges:

ChallengeSolution
Improper foldingUse specialized E. coli strains (like Transetta DE3) with enhanced folding capabilities
Toxicity to host cellsEmploy tightly regulated inducible expression systems
Inclusion body formationOptimize induction conditions (lower temperature, reduced IPTG concentration)
Low solubilityExpress with solubility-enhancing tags or fusion partners
Post-translational modificationsConsider eukaryotic expression systems for complex modifications
Metal center incorporationSupplement growth media with copper to ensure proper CuA center formation

The successful expression of functional MT-CO2 has been demonstrated in E. coli systems, with the recombinant protein showing catalytic activity toward cytochrome c oxidation . The incorporation of a His-tag facilitates purification using affinity chromatography with Ni²⁺-NTA agarose, allowing for the production of relatively pure protein (>90% as determined by SDS-PAGE) .

For functional studies, it's crucial to verify that the recombinant protein maintains its native conformation and activity. This can be assessed through spectroscopic methods and enzyme activity assays before proceeding with more complex investigations.

How can structure-function relationship studies of MT-CO2 contribute to understanding mitochondrial disease mechanisms?

Structure-function studies of MT-CO2 provide critical insights into mitochondrial disease mechanisms through several approaches:

Mitochondrial DNA, including MT-CO2, has been implicated in human evolution and disease . The first complete sequence of human mitochondrial DNA was published in 1981, catalyzing extensive research into its role in evolutionary studies and disease mechanisms. Understanding MT-CO2 structure-function relationships contributes to our knowledge of how mtDNA variations influence human health and disease susceptibility.

What are the most effective protocols for extracting and analyzing MT-CO2 from tissue samples?

Effective extraction and analysis of MT-CO2 from tissue samples involve several methodological considerations:

  • Tissue preparation and storage:

    • Flash-freeze tissues in liquid nitrogen immediately after collection

    • Store at -80°C for optimal preservation

    • Process tissues with minimal thawing to prevent protein degradation

  • Protein extraction:

    • Homogenize tissues in appropriate buffers containing protease inhibitors

    • For membrane proteins like MT-CO2, include gentle detergents for solubilization

    • Centrifuge at varying speeds to separate cellular components

  • Analysis methods:

    • Western blotting with MT-CO2-specific antibodies

    • Mass spectrometry for protein identification and post-translational modifications

    • Blue native PAGE for analyzing intact cytochrome c oxidase complexes

  • Meat juice extraction for antibody studies:

    • Store tissue samples at -20°C rather than -80°C for optimal meat juice yield

    • Thaw samples at 4°C to collect the exudate (meat juice)

    • Use in serological assays with appropriate dilution factors

Research has shown that the pre-thaw freeze temperature significantly affects the volume of meat juice retrieved, with samples stored at -20°C yielding more meat juice than those thawed from -80°C (p<0.05) . This methodology can be valuable for antibody studies related to MT-CO2 and other mitochondrial proteins.

What biophysical techniques are most informative for characterizing the metal centers in recombinant MT-CO2?

Characterization of metal centers in recombinant MT-CO2, particularly the CuA site, requires specialized biophysical techniques:

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Provides information on the oxidation state of copper centers

    • Allows detection of unpaired electrons in metal centers

    • Requires sample preparation under controlled redox conditions

  • X-ray Absorption Spectroscopy (XAS):

    • Offers element-specific information about the local structure around metal ions

    • Includes Extended X-ray Absorption Fine Structure (EXAFS) for bond distances

    • X-ray Absorption Near Edge Structure (XANES) for oxidation state determination

  • Resonance Raman Spectroscopy:

    • Selectively enhances vibrational modes associated with metal centers

    • Provides information on metal-ligand interactions

    • Requires proper laser wavelength selection to achieve resonance conditions

  • UV-Visible Spectroscopy:

    • Monitors changes in absorption spectra during redox reactions

    • Enables kinetic studies of electron transfer

    • Has been successfully used to demonstrate that recombinant MT-CO2 can catalyze the oxidation of cytochrome c

These techniques, particularly when used in combination, provide comprehensive characterization of the dual core CuA active site in MT-CO2, which is critical for understanding its electron transfer function in the respiratory chain.

How might advanced genetic editing techniques be applied to study MT-CO2 in model organisms?

Advanced genetic editing techniques offer unprecedented opportunities for studying MT-CO2 function in model organisms:

  • CRISPR/Cas9 mitochondrial genome editing:

    • Target specific regions of MT-CO2 for modification

    • Create precise point mutations mimicking disease variants

    • Generate knockdown/knockout models to assess functional consequences

  • Base editing and prime editing for mitochondrial DNA:

    • Introduce specific nucleotide changes without double-strand breaks

    • Create subtle modifications to study structure-function relationships

    • Address challenges of mitochondrial genome editing through innovative delivery methods

  • Heteroplasmy modulation:

    • Control the ratio of wild-type to mutant mtDNA

    • Study threshold effects in MT-CO2 mutations

    • Model progressive mitochondrial diseases

  • Tissue-specific mitochondrial editing:

    • Examine tissue-specific consequences of MT-CO2 mutations

    • Investigate differential sensitivity of tissues to respiratory chain defects

    • Develop targeted therapeutic approaches

These approaches will help address long-standing questions about mtDNA evolution and the role of specific MT-CO2 regions in electron transfer efficiency, potentially leading to novel therapeutic strategies for mitochondrial diseases.

What emerging computational methods show promise for predicting the functional impact of MT-CO2 variants?

Emerging computational methods for predicting the functional impact of MT-CO2 variants include:

  • Deep learning approaches:

    • Neural networks trained on extensive mutation datasets

    • Integration of sequence conservation, structural features, and functional data

    • Improved prediction accuracy over traditional methods

  • Molecular dynamics simulations:

    • Atomistic modeling of MT-CO2 variants in membrane environments

    • Assessment of structural stability and conformational changes

    • Prediction of alterations in electron transfer pathways

  • Quantum mechanics/molecular mechanics (QM/MM) methods:

    • Accurate modeling of electron transfer processes

    • Calculation of energy barriers for catalytic steps

    • Prediction of how mutations affect reaction mechanisms

  • Systems biology integration:

    • Modeling MT-CO2 variants within the context of the entire respiratory chain

    • Prediction of metabolic consequences of altered cytochrome c oxidase function

    • Integration with mitochondrial network models

These computational approaches, when validated with experimental data, will significantly enhance our ability to interpret novel MT-CO2 variants and prioritize candidates for functional studies, advancing both basic science and clinical applications in mitochondrial medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.