Recombinant Blakeslea trispora Bifunctional lycopene cyclase/phytoene synthase (carRA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Blakeslea trispora bifunctional lycopene cyclase/phytoene synthase (CarRA) is a genetically engineered enzyme critical for β-carotene biosynthesis. It catalyzes two sequential reactions: (1) phytoene synthase activity (condensing geranylgeranyl pyrophosphate into phytoene) and (2) lycopene cyclase activity (converting lycopene to β-carotene) . This enzyme is encoded by the carRA gene, which contains two functional domains: an N-terminal lycopene cyclase (R domain) and a C-terminal phytoene synthase (A/P domain) . Recombinant CarRA is widely used in metabolic engineering to enhance carotenoid production in microbial hosts .

Gene Architecture

  • Gene Length: 1,894 bp with a single 70 bp intron .

  • Protein: 69.6 kDa, comprising 608 amino acids in B. trispora .

  • Domains:

    • R domain (Lycopene cyclase): Converts lycopene to γ-carotene and β-carotene .

    • A/P domain (Phytoene synthase): Synthesizes phytoene from geranylgeranyl pyrophosphate .

Key Mutations in Overproducing Strains

MutationEffect on ActivityStrain
P143S (CarRA)Enhanced catalytic efficiencyB. trispora F-744
S528R (CarB)Improved phytoene dehydrogenase activityB. trispora F-744

These mutations increase β-carotene yields by up to 15-fold .

Recombinant Expression Systems

CarRA has been heterologously expressed in multiple hosts for industrial applications:

HostTagProtein LengthPuritySource
E. coliHisFull (1-608 aa)>90%Creative BioMart
BaculovirusN/APartial>85%Cusabio
Yarrowia lipolyticaNoneFullN/AEngineered strain

E. coli-expressed CarRA is commonly used for in vitro studies due to high solubility and yield .

Enzymatic Activities

SubstrateProductReaction Type
Geranylgeranyl pyrophosphatePhytoeneCondensation
Lycopeneβ-CaroteneCyclization

Kinetic Parameters (Engineered Yarrowia lipolytica)

ParameterValue
β-Carotene yield21.6 mg/g DCW
Total production1.7 g/L

These metrics highlight CarRA's superiority over homologs from Phycomyces blakesleeanus and Mucor circinelloides .

Case Study: β-Carotene Overproduction in Yarrowia lipolytica

  • Strategy: Codon-optimized carRA and carB (phytoene dehydrogenase) co-expression .

  • Results:

    • 21-fold increase in β-carotene content (12.5 mg/g DCW) by minimizing HMG-CoA and FPP accumulation .

    • Further tuning reduced lycopene and phytoene intermediates, achieving 1.7 g/L β-carotene .

Key Discoveries

  1. Regulation by crgA: Knockout of the negative regulator crgA in B. trispora upregulated carRA transcription by 80–160%, boosting β-carotene production by 31.2% .

  2. Metabolic Flux Redirection: Overexpression of carRA in Y. lipolytica redirected acetyl-CoA from the TCA cycle to carotenogenesis, increasing precursor availability .

  3. Domain Dependency: The R domain functions independently, but the A/P domain requires the R domain for stability .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
carRA; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-608
Protein Length
full length protein
Species
Blakeslea trispora (Choanephora trispora)
Target Names
carRA
Target Protein Sequence
MSILTYLEFHLYYTLPVLAALCWLLKPFHSQQDNLKYKFLMLMAASTASIWDNYIVYHRA WWYCPTCVVAVIGYVPLEEYMFFIIMTLMTVAFSNFVMRWHLHTFFIRPNTSWKQTLLVR LVPVSALLAITYHAWHLTLPNKPSFYGSCILWYACPVLAILWLGAGEYILRRPVAVLLSI VIPSVYLCWADIVAISAGTWHISLRTSTGKMVVPDLPVEECLFFTLINTVLVFATCAIDR AQAILHLYKSSVQNQNPKQAISLFQHVKELAWAFCLPDQMLNNELFDDLTISWDILRKAS KSFYTASAVFPSYVRQDLGVLYAFCRATDDLCDDESKSVQERRDQLDLTRQFVRDLFSQK TSAPIVIDWELYQNQLPASCISAFRAFTRLRHVLEVDPVEELLDGYKWDLERRPILDEQD LEAYSACVASSVGEMCTRVILAQDQKENDAWIIDRAREMGLVLQYVNIARDIVTDSETLG RCYLPQQWLRKEETEQIQQGNARSLGDQRLLGLSLKLVGKADAIMVRAKKGIDKLPANCQ GGVRAACQVYAAIGSVLKQQKTTYPTRAHLKGSERAKIALLSVYNLYQSEDKPVALRQAR KIKSFFVD
Uniprot No.

Target Background

Function

Recombinant Blakeslea trispora Bifunctional lycopene cyclase/phytoene synthase (carRA): A bifunctional enzyme catalyzing the conversion of geranylgeranyl diphosphate to phytoene (phytoene synthase activity) and lycopene to β-carotene via the intermediate γ-carotene (lycopene cyclase activity).

Protein Families
Lycopene beta-cyclase family; Phytoene/squalene synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genetic structure of the carRA gene in Blakeslea trispora?

The carRA gene in Blakeslea trispora has a total length of 1,894 base pairs (bp), which includes a single intron of 70 bp. The gene encodes a multifunctional protein of 69.6 kDa that contains separate domains for lycopene cyclase and phytoene synthase activities. The estimated transcript size for the carRA mRNA is approximately 1.9 kb, indicating efficient processing of the primary transcript. The bifunctional nature of this enzyme is particularly significant as it performs two sequential steps in the carotenoid biosynthetic pathway within a single polypeptide, contrasting with many other organisms where these functions are carried out by separate proteins.

How does the CarRA protein function as a bifunctional enzyme?

The CarRA protein functions as a bifunctional enzyme through its distinct catalytic domains that perform sequential steps in carotenoid biosynthesis. The phytoene synthase domain catalyzes the condensation of two geranylgeranyl pyrophosphate (GGPP) molecules to form phytoene, the first C40 carotenoid in the pathway. Subsequently, the lycopene cyclase domain introduces rings at both ends of the linear lycopene molecule to form β-carotene. This bifunctionality allows for coordinated regulation of these sequential enzymatic activities, potentially enhancing the efficiency of carotenoid production in B. trispora. The spatial relationship between these domains likely facilitates substrate channeling, where the product of the first reaction becomes the immediate substrate for the second enzymatic activity.

What mutations have been identified in the carRA gene of carotenoid-overproducing strains?

In the beta-carotene-overproducing strain Blakeslea trispora F-744, a significant P143S mutation has been identified in the CarRA protein. This proline to serine substitution at position 143 likely affects the protein's tertiary structure and catalytic efficiency, contributing to enhanced carotenoid production. While the exact mechanistic impact of this mutation remains to be fully characterized, it potentially alters substrate binding affinity, reaction kinetics, or protein stability. Comprehensive mutational analysis of the carRA gene region could reveal additional sequence variations that contribute to the overproduction phenotype and provide insights into structure-function relationships within this bifunctional enzyme.

What are the optimal vector systems for expressing recombinant carRA in heterologous hosts?

For effective expression of recombinant carRA from B. trispora, dual-promoter expression systems have shown considerable promise, drawing parallels with other complex recombinant protein production methods. A bidirectional vector design, similar to those used for recombinant antibody production, can be adapted for carRA expression by incorporating strong promoters like the enhanced CMV (eCMV) which has demonstrated superior expression levels in mammalian systems. For fungal expression systems, vectors containing constitutive promoters such as ADH1 or inducible promoters like GAL1 may be employed. The choice of expression vector should consider codon optimization for the host organism, presence of appropriate secretion signals if extracellular production is desired, and inclusion of purification tags that do not interfere with the bifunctional enzymatic activities.

How can Golden Gate cloning be optimized for recombinant carRA gene constructs?

Golden Gate cloning can be optimized for carRA gene constructs by implementing a one-step assembly approach similar to that demonstrated for antibody expression systems. This method utilizes type IIS restriction enzymes (such as BsaI or Esp3I) that cut outside their recognition sites to create unique cohesive ends. For the carRA gene, designing the construct with appropriate flanking recognition sites allows for seamless integration into expression vectors. The process can be further enhanced by:

  • Designing primers that introduce specific restriction sites flanking the carRA coding sequence

  • Removing any internal restriction sites through silent mutations

  • Incorporating appropriate regulatory elements and tags in a modular fashion

  • Optimizing reaction conditions (temperature cycling, buffer composition, enzyme concentrations)

This approach facilitates the rapid generation of multiple carRA expression constructs with various promoters, fusion tags, or mutations for comparative analysis of expression and activity.

What expression host systems are most effective for producing active recombinant CarRA enzyme?

The selection of an appropriate expression host is critical for obtaining functionally active recombinant CarRA enzyme. Based on analogous recombinant protein expression strategies, several host systems can be considered:

Host SystemAdvantagesLimitationsSpecial Considerations for CarRA
E. coliRapid growth, high yields, simple manipulationMay form inclusion bodies, lacks post-translational modificationsRequires codon optimization, may need fusion partners for solubility
Yeast (S. cerevisiae, P. pastoris)Eukaryotic processing, secretion capacityLonger culture times, hyperglycosylationNatural carotenoid pathway may interact with CarRA function
Mammalian cells (HEK293, CHO)Complex protein folding, authentic modificationsExpensive, lower yieldsBidirectional promoter systems like 2xeCMV show promise
Fungal systems (Aspergillus)Native-like environment for fungal proteinsComplex genetic manipulationMay provide chaperones specific to fungal protein folding

For CarRA specifically, yeast expression systems offer a good compromise between proper eukaryotic protein processing and reasonable yields, particularly as they can be engineered to provide precursors for carotenoid biosynthesis. The choice between different promoter systems, such as bidirectional promoters demonstrated in antibody production, can significantly impact expression levels and should be empirically tested.

How can the separate domains of CarRA be characterized functionally?

The separate domains of CarRA can be characterized through a combination of molecular biology, biochemistry, and structural biology approaches:

  • Domain mapping and mutagenesis: Create truncated versions of the protein containing either the phytoene synthase or lycopene cyclase domain, then assess their individual catalytic activities. Site-directed mutagenesis of conserved residues can identify catalytically essential amino acids in each domain.

  • Heterologous expression systems: Express the full-length protein and domain-specific constructs in systems like E. coli or yeast, then purify using affinity tags designed to minimize interference with enzyme function.

  • Enzyme assays: Develop specific assays for each catalytic function using chromatographic methods (HPLC) coupled with UV-vis or mass spectrometry detection to quantify substrate consumption and product formation.

  • Structural studies: Apply X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure, potentially revealing how the domains interact and function together.

  • Biophysical analyses: Utilize circular dichroism, fluorescence spectroscopy, and thermal shift assays to assess protein folding, stability, and substrate binding.

What protein engineering approaches can enhance CarRA enzymatic activity?

Several protein engineering strategies can be employed to enhance CarRA enzymatic activity:

Each of these approaches requires careful design of appropriate assay systems to accurately measure both phytoene synthase and lycopene cyclase activities, ideally in a high-throughput format to enable efficient screening of variant libraries.

How do post-translational modifications affect CarRA enzyme activity?

While specific information on post-translational modifications (PTMs) of CarRA from Blakeslea trispora is limited in the available research, potential PTMs and their effects can be inferred from studies on related enzymes:

  • Phosphorylation: Possible regulatory mechanism that could alter enzyme activity in response to cellular conditions. Key serine, threonine, or tyrosine residues might serve as phosphorylation sites that modulate activity through conformational changes.

  • Glycosylation: May affect protein stability, solubility, and potentially substrate recognition. When expressing recombinant CarRA in different host systems, differences in glycosylation patterns could significantly impact enzymatic performance.

  • Proteolytic processing: Limited proteolysis might occur naturally to regulate enzyme activity or as part of protein maturation. This could be particularly relevant if there are linker regions between the two functional domains.

  • Disulfide bond formation: Correct formation of disulfide bonds, if present, would be essential for proper folding and activity, requiring an oxidizing environment during protein expression and purification.

Experimental approaches to study these modifications include mass spectrometry analysis of the purified protein, site-directed mutagenesis of potential modification sites, and comparative analysis of the enzyme expressed in different host systems with varying capacities for post-translational processing.

What are the optimal conditions for assaying lycopene cyclase and phytoene synthase activities separately?

Optimal conditions for assaying the separate enzymatic activities of CarRA require careful consideration of substrate preparation, reaction conditions, and detection methods:

For phytoene synthase activity:

  • Substrate: Geranylgeranyl pyrophosphate (GGPP)

  • Buffer: Typically Tris-HCl (pH 7.0-7.5) with MgCl₂ (5-10 mM) as a cofactor

  • Detection: HPLC analysis with UV detection at 286 nm for phytoene

  • Controls: Include known phytoene synthase inhibitors as negative controls

For lycopene cyclase activity:

  • Substrate: Purified lycopene (requiring specialized preparation due to hydrophobicity)

  • Buffer: Similar to phytoene synthase but may require detergent or phospholipid addition for substrate solubilization

  • Detection: HPLC coupled with diode array detection to monitor the disappearance of lycopene (λmax 472 nm) and appearance of β-carotene (λmax 450 nm)

  • Controls: Known lycopene cyclase inhibitors

For both assays, recombinant enzyme preparation methods significantly impact activity measurements. Using bidirectional expression systems like those described for antibody production can ensure consistent enzyme quality. Temperature, pH optimization, and the presence of reducing agents should be empirically determined for each activity, as the optimal conditions may differ between the two enzymatic functions.

How can isotopic labeling be used to track CarRA enzyme kinetics in vivo?

Isotopic labeling provides powerful insights into enzyme kinetics within living cells, offering a comprehensive view of CarRA activity in its natural cellular context:

  • ¹³C-labeled precursors: Introduction of ¹³C-labeled acetate or mevalonate (early precursors in the isoprenoid pathway) allows tracking of carbon flow through the carotenoid biosynthetic pathway using mass spectrometry.

  • Pulse-chase experiments: Brief exposure to labeled precursors followed by unlabeled compounds enables determination of pathway flux rates and potential rate-limiting steps.

  • Position-specific labeling: Using precursors with ¹³C at specific positions can reveal mechanistic details of the cyclization reaction, particularly bond formation and breaking events.

  • Coupling with transcriptomics/proteomics: Combining isotopic labeling with global analysis of gene expression and protein levels provides a systems-level understanding of regulation.

  • In vivo NMR spectroscopy: For organisms amenable to NMR analysis, real-time tracking of metabolite formation using ¹³C or ²H labeled precursors can provide unprecedented temporal resolution of pathway dynamics.

Implementation of these techniques requires careful experimental design and sophisticated analytical capabilities, but yields comprehensive insights into enzyme behavior in the cellular context that cannot be obtained through in vitro assays alone.

What computational approaches can predict the effect of mutations on CarRA functionality?

Computational approaches provide valuable insights for predicting mutation effects on CarRA functionality, guiding experimental design, and interpreting observed phenotypes:

  • Homology modeling: In the absence of a crystal structure, models based on related enzymes with known structures can predict the three-dimensional arrangement of CarRA, including the spatial relationship between domains and the location of active sites.

  • Molecular dynamics simulations: These can reveal how mutations like the P143S variation found in overproducing strains affect protein flexibility, substrate binding, and domain communication over time scales not accessible to experimental methods.

  • Quantum mechanics/molecular mechanics (QM/MM): For detailed understanding of catalytic mechanisms, QM/MM can model electronic states during catalysis, particularly useful for understanding how mutations might affect transition states.

  • Machine learning approaches: Training algorithms on datasets of known mutations in related enzymes can generate predictive models for novel mutations, especially when integrated with structural and evolutionary information.

  • Evolutionary analysis and conservation mapping: Identifying conserved residues across species helps prioritize functionally important regions, with mutations in these areas likely to have significant functional consequences.

These computational approaches are most powerful when integrated with experimental validation, creating an iterative cycle of prediction, testing, and refinement that accelerates understanding of structure-function relationships in the CarRA enzyme.

How can researchers address the insolubility issues often encountered with recombinant carotenoid pathway enzymes?

Insolubility is a common challenge when working with carotenoid pathway enzymes like CarRA, but several strategies can mitigate this issue:

  • Fusion protein approaches: Utilizing solubility-enhancing tags such as MBP (maltose-binding protein), SUMO, or Thioredoxin can dramatically improve the solubility of recombinant CarRA. The tag placement should be optimized to avoid interfering with the bifunctional enzyme's active sites.

  • Expression conditions optimization: Lowering induction temperature (16-20°C), reducing inducer concentration, and slowing protein expression rate can allow more time for proper folding, significantly enhancing solubility.

  • Co-expression with chaperones: Molecular chaperones like GroEL/GroES, DnaK/DnaJ/GrpE, or fungal-specific chaperones can assist proper folding of CarRA during expression.

  • Detergent screening: Systematically testing various detergents at different concentrations can identify conditions that maintain CarRA in solution without compromising activity. Non-ionic detergents like Triton X-100 or DDM often work well with membrane-associated enzymes.

  • Nanodiscs or liposome reconstitution: Incorporating the purified enzyme into lipid environments that mimic native membranes can stabilize the protein and enhance activity, particularly relevant for the lycopene cyclase domain which may interact with membranes.

Implementing a combination of these approaches, potentially in a high-throughput screening format, can identify optimal conditions for producing soluble, active CarRA enzyme for subsequent structural and functional studies.

What strategies can resolve contradictory data on CarRA domain interactions and substrate channeling?

Contradictory data on domain interactions and substrate channeling in bifunctional enzymes like CarRA require sophisticated approaches to resolve:

  • Cross-linking studies coupled with mass spectrometry: Chemical or photo-cross-linking followed by mass spectrometric analysis can capture transient interactions between domains and identify specific residues involved in domain communication.

  • Single-molecule FRET (Förster Resonance Energy Transfer): By introducing fluorescent labels at specific positions in each domain, FRET measurements can detect distance changes during catalysis, providing direct evidence of conformational dynamics related to substrate channeling.

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry): This technique can map regions of the protein that show altered solvent accessibility during catalysis, revealing dynamic aspects of domain interaction.

  • Cryo-EM conformational ensembles: Recent advances in cryo-electron microscopy allow visualization of multiple conformational states within a single sample, potentially capturing the dynamic nature of domain interactions during the catalytic cycle.

  • Time-resolved spectroscopy: Using stopped-flow techniques coupled with spectroscopic detection can track the kinetics of sequential reactions, providing evidence for or against substrate channeling between domains.

  • Analytical ultracentrifugation and light scattering: These techniques can detect changes in protein shape and oligomerization state that might accompany catalysis or substrate binding.

By employing multiple complementary approaches and carefully controlling experimental conditions, researchers can build a consensus model that reconciles apparently contradictory observations about CarRA's complex enzymatic mechanism.

How can researchers overcome challenges in analyzing carotenoid intermediates in CarRA enzymatic assays?

Analyzing carotenoid intermediates presents unique challenges due to their hydrophobicity, oxidation sensitivity, and spectral similarities. These challenges can be addressed through:

  • Specialized extraction protocols: Optimized solvent systems (typically hexane/ethyl acetate/acetone mixtures) and extraction procedures that prevent oxidation through the use of antioxidants (BHT) and inert atmosphere during sample preparation.

  • Advanced chromatographic techniques:

    • Ultra-high performance liquid chromatography (UHPLC) with C30 columns specifically designed for carotenoid separation

    • Temperature-controlled separation to prevent on-column degradation

    • Gradient elution protocols optimized for resolving structurally similar intermediates

  • Multi-detector setups:

    • Diode array detectors for full spectral acquisition

    • Mass spectrometry with atmospheric pressure chemical ionization (APCI) for structural confirmation

    • Advanced MS/MS fragmentation patterns to distinguish isomeric carotenoids

  • Derivatization approaches: Chemical modification of specific functional groups can enhance separation and detection of otherwise similar carotenoid intermediates.

  • In situ monitoring: Development of spectroscopic methods that can monitor reactions in real-time without extraction steps, potentially using specialized probes or reporter systems.

  • Stable isotope labeling: Incorporation of heavy isotopes at specific positions can facilitate tracking of intermediates through the reaction pathway using mass spectrometry.

Implementation of these techniques requires specialized equipment and expertise but provides unparalleled insights into the complex cascade of reactions catalyzed by the bifunctional CarRA enzyme.

How might CRISPR-Cas9 genome editing advance the study of carRA gene function in Blakeslea trispora?

CRISPR-Cas9 genome editing offers transformative potential for studying carRA gene function in Blakeslea trispora through several innovative approaches:

Implementation challenges include optimizing transformation protocols for Blakeslea trispora and developing appropriate selection markers. Drawing from bidirectional promoter technologies used in other recombinant systems could enhance the efficiency of CRISPR component expression. Success with these approaches would significantly accelerate fundamental understanding of this bifunctional enzyme and enable rational strain improvement for both research and potential biotechnological applications.

What emerging structural biology techniques could reveal new insights about CarRA enzyme mechanisms?

Emerging structural biology techniques offer unprecedented opportunities to understand the complex mechanisms of bifunctional enzymes like CarRA:

  • Cryo-electron microscopy (cryo-EM): Recent advances in direct electron detectors and image processing have enabled structure determination at near-atomic resolution without the need for crystallization. This is particularly valuable for capturing different conformational states of CarRA during catalysis.

  • Time-resolved X-ray crystallography: Using X-ray free-electron lasers (XFELs) can capture structural snapshots of enzymatic reactions on the femtosecond to millisecond timescale, potentially revealing transient intermediates in the CarRA catalytic cycle.

  • Integrative structural biology approaches: Combining data from multiple techniques (X-ray crystallography, cryo-EM, NMR, small-angle X-ray scattering) can provide comprehensive structural models that capture both stable and dynamic aspects of CarRA function.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can map protein dynamics and conformational changes upon substrate binding or during catalysis, revealing allosteric communication between the two enzymatic domains.

  • Microcrystal electron diffraction (MicroED): Allows structure determination from extremely small crystals, potentially overcoming difficulties in growing large crystals of membrane-associated enzymes like CarRA.

  • Single-molecule techniques: Methods like force spectroscopy or single-molecule FRET can track conformational changes in individual CarRA molecules during catalysis, revealing heterogeneity that might be masked in ensemble measurements.

These advanced structural approaches, particularly when combined with functional assays and computational modeling, promise to provide unprecedented insights into how the bifunctional nature of CarRA enables coordinated catalysis of sequential reactions in carotenoid biosynthesis.

How can systems biology approaches enhance our understanding of carRA in the context of the complete carotenoid biosynthetic pathway?

Systems biology approaches offer a holistic framework for understanding carRA function within the broader context of carotenoid biosynthesis and cellular metabolism:

Implementation of these approaches requires sophisticated computational infrastructure and interdisciplinary collaboration but provides a comprehensive understanding of how this bifunctional enzyme operates within its native biological context, potentially revealing non-intuitive interventions for enhancing carotenoid production or pathway regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.