Recombinant Blattabacterium sp. subsp. Periplaneta americana Sec-independent protein translocase protein TatC (tatC)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Blattabacterium sp. subsp. Periplaneta americana Sec-independent protein translocase TatC is a genetically engineered variant of the TatC protein, a critical component of the twin-arginine translocation (Tat) system. This system transports folded proteins across bacterial cytoplasmic or organellar membranes . In Blattabacterium—an endosymbiont of cockroaches—TatC facilitates the transport of redox enzymes and other folded substrates critical for host-symbiont metabolic interactions .

Protein Characteristics

PropertyDetails
Gene NametatC (BPLAN_242)
UniProt IDD0J948
Protein LengthFull-length (1–266 amino acids)
Host Expression SystemE. coli or cell-free expression
TagN-terminal 10xHis tag
Purity≥85% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer with 6% trehalose (pH 8.0)

Role in the Tat System

TatC acts as the central receptor in the Tat translocase, binding signal peptides of substrate proteins via a conserved twin-arginine (RR) motif . Structural studies of TatC homologs (e.g., Aquifex aeolicus) reveal a six-transmembrane helix topology with a conserved "cupped hand" conformation critical for substrate recognition .

Key Features

  • Substrate Specificity: Recognizes folded proteins, including redox enzymes and amidases .

  • Quality Control: Discriminates against misfolded proteins through interactions with TatB .

  • Essentiality: In pathogens like Helicobacter pylori, TatC is indispensable for viability, underscoring its role in cell envelope integrity .

Expression and Purification

  • Expression: Produced in E. coli or mammalian cell systems .

  • Reconstitution: Lyophilized protein is solubilized in sterile water or glycerol-containing buffers for stability .

Research Applications

  • Mechanistic Studies: Used to dissect Tat system architecture and substrate recognition .

  • Biotechnological Tools: Potential for exporting folded enzymes in industrial biocatalysis .

Research Findings

  • Genomic Context: The tatC gene is part of a reduced genome in Blattabacterium, reflecting evolutionary adaptation to an endosymbiotic lifestyle .

  • Functional Redundancy: In Bacillus subtilis, multiple TatC paralogs enable substrate-specific translocation .

  • Essential Role: Conditional tatC mutants in H. pylori require IPTG for survival, highlighting its non-redundant function .

Industrial and Medical Relevance

  • Antibiotic Development: TatC’s essentiality in pathogens makes it a potential drug target .

  • Enzyme Engineering: Enables export of complex, cofactor-dependent enzymes for biofuel and pharmaceutical production .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
tatC; BPLAN_242; Sec-independent protein translocase protein TatC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Blattabacterium sp. subsp. Periplaneta americana (strain BPLAN) (Periplaneta americana symbiotic bacterium)
Target Names
tatC
Target Protein Sequence
MKNEKNEMPFWEHIEELRKHLIHSVCAMIIATIILMNNKNVIFDYILFGPAKTDFITYRL FHKLGKIFHRSHHSFYFFSHNLEIQNRQIFGQFNIYVWTCFIGGFILSFPYIFYEFWKFI KPALSDEERKYSRGIIMMVTFLFILGVLFGYFILCPFLIHFGYTFRISSFPRNIFDLSDY ISLIMHSILSMGITFLFPIFIYFLTKIELISYPFLKKYRKHAFLILLILASAITPGDIFS TIVVLIPLMILYQFSIYISFYVSKKK
Uniprot No.

Target Background

Function
This protein is a component of the twin-arginine translocation (Tat) system, which is responsible for transporting large, folded proteins across membranes. These proteins possess a distinctive twin-arginine motif within their signal peptide.
Database Links
Protein Families
TatC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Tat pathway and how does TatC function within it?

The twin arginine transport (Tat) pathway exports folded proteins across the cytoplasmic membranes of prokaryotes and the thylakoid membranes of chloroplasts. In Blattabacterium sp. associated with Periplaneta americana, as in other Gram-negative bacteria, the Tat machinery comprises TatA, TatB, and TatC components. TatC forms the core of the Tat receptor complex, which binds Tat substrates and triggers receptor organization and recruitment of additional TatA molecules to form the active Tat translocon. The polytopic membrane protein TatC harbors two binding sites for the sequence-related TatA and TatB proteins .

How does TatC differ from Sec-dependent protein translocase systems?

The Tat pathway operates in parallel to the general secretory (Sec) system but with a critical distinction: while Sec transports unfolded proteins, the Tat system specifically exports fully folded proteins across membranes. In Blattabacterium, TatC functions as the core component of the Sec-independent pathway, recognizing twin-arginine signal peptides on substrate proteins, whereas Sec-dependent systems recognize different signal sequences and employ different mechanisms for protein translocation .

What is the genomic context of tatC in Blattabacterium sp. subsp. Periplaneta americana?

The tatC gene is maintained in Blattabacterium sp. despite the extensive genome reduction observed in this endosymbiont. Blattabacterium genomes typically range from 609-637 kbp with GC content between 23.8-26.3%, depending on the host cockroach species . The maintenance of tatC suggests its critical function in the reduced metabolic network of this obligate endosymbiont, likely playing an essential role in the transport of proteins involved in nitrogen recycling and other vital metabolic processes.

What are the key structural features of TatC in Blattabacterium?

TatC is a polytopic membrane protein with multiple transmembrane helices (TMH). Based on research on homologous TatC proteins, it contains at least six transmembrane domains. Critical functional regions include a "polar" cluster binding site formed by TatC transmembrane helices 5 and 6, which is occupied by TatB in the resting receptor and exchanges for TatA during receptor activation. A second binding site lies further along TMH6 and is occupied by TatA in the resting state .

How do TatA and TatB interact with TatC?

TatA and TatB are sequence-related proteins that interact with TatC at specific binding sites. The "polar" cluster binding site formed by TatC transmembrane helices 5 and 6 is occupied by TatB in the resting receptor and exchanges for TatA during receptor activation. The second binding site along TMH6 is occupied by TatA in the resting state. These interactions are critical for the assembly and function of the Tat translocon .

What is known about critical residues in TatC that affect protein transport?

Mutagenesis studies have identified several critical residues in TatC that, when mutated, disrupt protein transport. Three stably produced TatC variants—P221R, M222R, and L225P—are inactive for protein transport despite not affecting the assembly of the Tat receptor or abolishing TatA/TatB binding. These residues are located in the second binding site region along TMH6, indicating this region's critical function in the Tat pathway .

How has molecular dynamics been used to study TatC-TatA/TatB interactions?

Molecular dynamics (MD) simulations have been employed to understand the structural changes and interaction dynamics between TatC and its binding partners. These simulations help predict how amino acid substitutions might affect protein-protein interactions. For example, MD simulations combined with crosslinking analysis have demonstrated that bulky substitutions in the TatA binding site can substantially reduce TatA binding without completely eliminating Tat function. This suggests complex and potentially redundant interaction mechanisms in the Tat system .

What evolutionary patterns are observed in tatC across Blattabacterium strains?

The tatC gene has been maintained despite extensive parallel genome erosion observed in Blattabacterium across different cockroach lineages. While many genes involved in amino acid synthesis (like those for methionine and branched-chain amino acids) have been lost in some lineages, essential protein transport machinery like the Tat system appears to be conserved. This suggests strong selective pressure to maintain protein transport functions even as the genome undergoes reduction .

How does Blattabacterium TatC function compare with that of free-living bacteria?

Blattabacterium, as an obligate endosymbiont with a reduced genome (609-637 kbp), likely maintains only essential protein transport machinery. While the core functional domains of TatC are conserved, the protein may have adapted to the specific metabolic needs of the endosymbiotic lifestyle. Since Blattabacterium is primarily involved in nitrogen recycling and amino acid provisioning for its host, TatC likely specializes in transporting proteins involved in these pathways, potentially showing functional adaptations compared to free-living bacteria with more diverse metabolic capabilities .

What recombinant expression systems are most suitable for Blattabacterium TatC?

For recombinant expression of Blattabacterium TatC, E. coli-based expression systems are typically most suitable due to genetic tractability and the relatedness of both organisms (both being Gram-negative bacteria). Key considerations include:

  • Codon optimization for E. coli expression, accounting for the low GC content (23.8-26.3%) of Blattabacterium genes

  • Use of fusion tags (His, GST, MBP) to improve solubility and facilitate purification

  • Employment of specialized membrane protein expression strains like C41(DE3) or C43(DE3)

  • Temperature optimization (typically lower temperatures of 18-25°C) to prevent inclusion body formation

  • Induction conditions that balance expression yield with proper membrane insertion

How can site-directed mutagenesis be effectively applied to study TatC function?

Site-directed mutagenesis represents a critical approach for analyzing structure-function relationships in TatC. Based on research findings, an effective methodology includes:

Mutagenesis TargetRationaleExpected EffectAnalysis Method
P221, M222, L225Critical residues in TMH6 binding siteDisruption of protein transportIn vivo transport assays
TMH5/6 interfacePolar cluster binding siteAltered TatB bindingCrosslinking analysis
Bulky residues in TMH6TatA binding siteReduced TatA interactionMD simulations and crosslinking

For optimal results, researchers should implement complementary assays including in vivo transport assays, crosslinking analysis, and MD simulations to comprehensively characterize mutant phenotypes .

What crosslinking strategies are most informative for studying TatC interactions?

Crosslinking analysis provides valuable insights into protein-protein interactions within the Tat system. Optimal approaches include:

  • In vivo photo-crosslinking using genetically incorporated unnatural amino acids (like p-benzoyl-L-phenylalanine)

  • Chemical crosslinking with homobifunctional reagents (DSS, BS3) for lysine-lysine crosslinks

  • Heterobifunctional crosslinkers that target different functional groups for more specific interaction mapping

  • Analysis of crosslinked products via SDS-PAGE followed by western blotting or mass spectrometry

These approaches have successfully identified interactions between TatC transmembrane helices and TatA/TatB proteins, revealing that even with reduced binding at the TMH6 site, TatC can retain function .

How should researchers interpret phenotypic data from TatC mutants?

When analyzing TatC mutant phenotypes, researchers should consider the following interpretive framework:

Phenotypic ObservationPossible InterpretationFollow-up Experiments
Loss of protein transport with intact complex assemblyFunctional rather than structural defectMD simulations, crosslinking analysis
Reduced but not eliminated transport activityPartial disruption or compensatory mechanismsSuppressor mutation screens, complementation assays
No effect on TatA/TatB binding despite lost functionCritical region for substrate interaction or conformational changeSubstrate binding assays, conformational probes

As demonstrated with the P221R, M222R, and L225P variants, the absence of transport activity despite normal complex assembly suggests these residues affect a functional aspect of the transport cycle rather than initial complex formation .

What comparative genomic approaches yield insights into TatC evolution in Blattabacterium?

Comparative genomic analysis of tatC across Blattabacterium strains from different cockroach hosts reveals evolutionary patterns related to endosymbiont genome reduction:

Blattabacterium SourceGenome Size (kbp)GC Content (%)tatC StatusCorrelation with Host Ecology
Soil-burrowing cockroaches609-61623.8-24.1MaintainedEssential for endosymbiont function despite reduced genome
Cryptocercus species637~24-26MaintainedLarger genome, wood-feeding host
Non-soil-burrowing species614-63223.9-26.3MaintainedVarious host feeding strategies

This comparative approach reveals that tatC is conserved across Blattabacterium strains despite differential gene loss in other functional categories, suggesting its essential role in the endosymbiont-host relationship regardless of ecological niche .

What are the key technical challenges in studying Blattabacterium TatC?

Researching Blattabacterium TatC presents several significant technical challenges:

  • Inability to culture Blattabacterium outside its host cockroach

  • Limited genetic manipulation systems for obligate endosymbionts

  • Difficulty in isolating sufficient quantities of native protein

  • Potential toxicity of overexpressed membrane proteins in heterologous systems

  • Crystallization challenges for structural studies of membrane proteins

These limitations necessitate creative approaches, including heterologous expression, in silico modeling based on homologs, and indirect functional assays using recombinant systems.

How might TatC function in relation to nitrogen recycling in the Blattabacterium-cockroach symbiosis?

TatC likely plays a crucial role in the nitrogen recycling function of Blattabacterium by facilitating the transport of folded proteins involved in uric acid degradation and ammonia assimilation. Future research directions should explore:

  • Identification of specific Tat substrates in Blattabacterium using bioinformatic prediction tools

  • Correlation between TatC function and nitrogen metabolism in different cockroach species

  • Potential adaptations of the Tat system in relation to the endosymbiotic lifestyle

  • Comparison with homologous systems in other insect endosymbionts

Understanding these relationships could provide insights into the co-evolution of cockroaches and their endosymbionts, particularly in the context of nitrogen-poor diets .

What emerging technologies might advance our understanding of TatC function?

Several cutting-edge technologies hold promise for deepening our understanding of TatC function:

  • Cryo-electron microscopy for structural determination of the complete Tat complex

  • Single-molecule tracking to visualize Tat-mediated transport in real-time

  • Advanced MD simulations incorporating lipid environments specific to Blattabacterium

  • Synthetic biology approaches to reconstruct minimal Tat systems

  • Systems biology integration of proteomic, transcriptomic, and metabolomic data

These approaches could help resolve outstanding questions about the precise mechanism of Tat-mediated protein transport and the specific adaptations of this system in Blattabacterium compared to free-living bacteria .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.