Recombinant Blochmannia pennsylvanicus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Blochmannia pennsylvanicus ATP Synthase Subunit a (atpB)

ATP synthase subunit a (encoded by atpB) is a membrane-embedded component of the F<sub>O</sub> sector of ATP synthase, essential for proton translocation during ATP synthesis . Recombinant versions of this subunit are produced in Escherichia coli with a His-tag for purification .

PropertyDetails
Gene NameatpB
UniProt IDQ494C9
Protein Length269 amino acids (full-length)
Host SystemE. coli
TagN-terminal His-tag
Molecular Weight~30 kDa (predicted)
Key FunctionProton channel formation in ATP synthase F<sub>O</sub> sector

Role in ATP Synthase Mechanism

The B. pennsylvanicus ATP synthase operates via rotational catalysis:

  1. Proton Translocation: Subunit a facilitates proton flow across the membrane, driving rotation of the c-ring .

  2. Energy Coupling: Mechanical energy from rotation is transmitted to the F<sub>1</sub> sector (subunits α, β, γ) for ATP synthesis .

Genomic and Evolutionary Insights

  • B. pennsylvanicus retains a highly conserved ATP synthase operon compared to B. floridanus, despite accelerated amino acid substitution rates (~10–50× faster than free-living bacteria) .

  • Pseudogenization: Loss of murI and coaADE in B. floridanus contrasts with retention in B. pennsylvanicus, suggesting divergent metabolic dependencies .

Applications and Availability

Recombinant atpB is commercially available for:

  • Functional Studies: Proton translocation assays and mutagenesis .

  • Antibody Production: Immunogenic epitopes for symbiont-specific diagnostics .

SupplierCatalog NumberPurityPrice Range
Creative BioMartRFL15056BF≥85%$400–$600 (50 µg)
CUSABIO TECHNOLOGY LLCCB915629002≥90%$500–$800 (100 µg)
MyBioSourceMBS26272≥85%$300–$500 (50 µg)

Challenges and Future Directions

  • Expression Issues: Membrane protein insolubility complicates purification .

  • Functional Redundancy: Subunit a’s role overlaps with mitochondrial counterparts, requiring species-specific studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; BPEN_002; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Blochmannia pennsylvanicus (strain BPEN)
Target Names
atpB
Target Protein Sequence
MSGIKGTSQEYIGHHLYHLQFDLSTFSLVSSENTSSFWVLNVDSMFFSILLATLFLLIFG RLATVATYAVPTKLQVFIELVILFIDSNVKDMFHGKNKLIAPLSMTVFVWIFLMNTMDLF PIDLFPAIAKLLGLPALRVVPSADVNITSSLALNVFVLVMYYNIYVNGVHGFIKGLMYHP FNHPTCIPINFIIEVVSLLSKPVSLSLRLFGNMYSGELIFILISGLLPWWGQWVLNLPWA IFHILVVTLQAFIFMVLTVIYLSTAHDSC
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ATP synthase subunit a (atpB) in bacterial energy metabolism?

ATP synthase is a crucial enzyme complex that produces ATP from ADP and inorganic phosphate using energy from a transmembrane proton motive force. Subunit a plays a critical role in the proton translocation pathway within the membrane-embedded F₀ region of ATP synthase. Based on structural studies of bacterial ATP synthases, subunit a forms part of the proton channel that allows protons to pass through the membrane, driving the rotation of the c-ring which is coupled to ATP synthesis in the F₁ region . The proton translocation mechanism involves two offset half-channels in the membrane region, allowing protons to enter from one side of the membrane and exit on the other . This transmembrane proton flow is essential for the rotary mechanism that powers ATP synthesis.

How does Blochmannia pennsylvanicus ATP synthase structure compare to other bacterial ATP synthases?

While the search results don't provide specific structural information about B. pennsylvanicus ATP synthase, bacterial ATP synthases are generally simpler than their mitochondrial counterparts while performing the same core functions . Bacterial ATP synthases typically consist of eight different subunits (α₃β₃γδεab₂c₁₀-₁₅) arranged into the F₁ (α₃β₃γδε) and F₀ (ab₂c₁₀-₁₅) regions. The B. pennsylvanicus ATP synthase likely shares this fundamental architecture, with specific adaptations related to its endosymbiotic lifestyle within carpenter ants. The c-ring typically contains 10 subunits in many bacterial ATP synthases, as observed in the Bacillus PS3 ATP synthase (c₁₀) .

What experimental challenges are associated with working with recombinant Blochmannia proteins?

Blochmannia pennsylvanicus is an endosymbiotic bacterium with a reduced genome, which presents several experimental challenges:

  • Expression system selection: As an endosymbiont, Blochmannia has coevolved with its host, potentially resulting in unusual codon usage or protein folding requirements.

  • Membrane protein solubility: ATP synthase subunit a is a hydrophobic membrane protein that can be difficult to express in soluble form. The search results indicate that for other bacterial ATP synthase components, specialized storage conditions (e.g., Tris-based buffer with 50% glycerol) are recommended .

  • Functional reconstitution: Demonstrating the activity of an isolated subunit is challenging, as ATP synthase functions as a complex with multiple interacting components.

  • Protein stability: Recombinant membrane proteins often require careful handling to maintain structural integrity, with recommendations against repeated freeze-thaw cycles .

How does the proton translocation mechanism in subunit a coordinate with c-ring rotation in bacterial ATP synthases?

The mechanism of proton translocation through the F₀ region involves a complex interaction between subunit a and the c-ring. Based on structural studies of bacterial ATP synthases, proton translocation occurs via two offset half-channels in subunit a . Protons enter through one half-channel, bind to a conserved carboxylate residue on a c subunit, and then exit through the second half-channel after the c-ring rotates . This process causes rotation of the entire rotor subcomplex (subunits γεc₁₀), inducing conformational changes in the F₁ region.

In the Bacillus PS3 ATP synthase structure, researchers observed three distinct rotational states with rotation steps corresponding to movements of approximately 3, 4, and 3 c-subunits . This asymmetric stepping pattern results from the symmetry mismatch between the three αβ pairs in the F₁ region and the ten c-subunits in the F₀ region . The 120° steps of the F₁ motor translate to an average rotational step of 3.3 c-subunits . This coordinated movement couples proton flow to ATP synthesis through long-range conformational changes.

What are the structural determinants of proton selectivity in bacterial ATP synthase subunit a?

The proton selectivity of subunit a depends on several structural features:

  • Arrangement of transmembrane helices: The transmembrane helices in subunit a form the two half-channels for proton translocation.

  • Conserved charged residues: Specific charged amino acids in subunit a are critical for mediating proton movement.

  • Interaction with c-ring: The interface between subunit a and the c-ring creates a hydrophobic barrier that prevents proton leakage.

  • Essential arginine residue: A highly conserved arginine in subunit a plays a crucial role in the proton transfer mechanism, interacting with the c-ring carboxylate during proton translocation .

The structures of bacterial ATP synthases reveal that subunit a and the c-ring are held together primarily by hydrophobic interactions rather than by the peripheral stalk . These specific structural features ensure that proton flow is tightly coupled to ATP synthesis.

How do the different rotational states of ATP synthase affect the conformation of the peripheral stalk?

Cryo-EM studies of bacterial ATP synthases reveal that the peripheral stalk (primarily composed of subunits b and δ) shows significant conformational flexibility across different rotational states . In the Bacillus PS3 ATP synthase, the C-terminal water-soluble part of subunit b displays the most significant conformational variability between states, while the F₁ region subunits show limited flexibility beyond the catalytic states of the αβ pairs .

This flexibility in the peripheral stalk is functionally important as it:

  • Allows the stator (subunits ab₂) to remain fixed while accommodating the rotation of the central rotor (subunits γεc₁₀)

  • Provides elastic energy storage during the catalytic cycle

  • Maintains the structural integrity of the complex during rotation

The bacterial peripheral stalk is structurally simpler and more flexible than its mitochondrial counterpart, suggesting a more direct mechanical coupling between the F₀ and F₁ regions .

What role does subunit ε play in the regulation of bacterial ATP synthase activity?

Subunit ε plays a crucial regulatory role in bacterial ATP synthases by inhibiting ATP hydrolysis while allowing ATP synthesis. The structure of bacterial ATP synthases reveals that subunit ε can adopt different conformations:

  • In the "up" conformation, subunit ε inhibits ATP hydrolysis by physically blocking the rotation of the central stalk in the hydrolysis direction .

  • In the "down" conformation, it permits ATP synthesis and/or hydrolysis.

In Bacillus PS3 ATP synthase, this subunit ε-mediated inhibition is dependent on the concentration of free ATP . Low ATP concentrations (<0.7 mM) promote the inhibitory "up" conformation, while a permissive "down" conformation can be induced by high ATP concentrations (>1 mM) . This regulatory mechanism prevents wasteful ATP hydrolysis when cellular ATP levels are low, while allowing ATP synthesis or hydrolysis when appropriate.

ATP ConcentrationSubunit ε ConformationFunctional Effect
<0.7 mM"Up" conformationInhibits ATP hydrolysis
>1.0 mM"Down" conformationPermits ATP synthesis/hydrolysis

What expression systems are optimal for producing recombinant Blochmannia pennsylvanicus ATP synthase subunits?

Based on approaches used for other bacterial ATP synthases, the following expression systems may be suitable for B. pennsylvanicus ATP synthase subunits:

  • E. coli expression systems: E. coli has been successfully used to express other bacterial ATP synthases, as demonstrated with Bacillus PS3 ATP synthase . For membrane proteins like subunit a, specialized E. coli strains (C41, C43) designed for membrane protein expression may be beneficial.

  • Expression constructs: Adding affinity tags (His-tag) to facilitate purification is recommended, similar to the N-terminal 10×His tag used for Bacillus PS3 ATP synthase subunit β .

  • Growth conditions: For membrane proteins, lower induction temperatures (16-25°C) often improve proper folding and membrane insertion.

  • Membrane extraction: Gentle detergents like DDM (n-dodecyl-β-D-maltoside) are typically used for extracting membrane proteins without denaturation.

The exact conditions would need to be optimized empirically for B. pennsylvanicus proteins, considering their specific characteristics.

What purification strategies are effective for recombinant ATP synthase subunits?

Effective purification strategies for ATP synthase subunits typically involve:

  • Affinity chromatography: For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins provides a good initial purification step .

  • Size exclusion chromatography: This technique separates proteins based on size and can help isolate properly folded protein from aggregates.

  • Ion exchange chromatography: This can provide additional purification based on the protein's charge properties.

  • Detergent considerations: For membrane proteins like subunit a, maintaining an appropriate detergent concentration throughout purification is critical to prevent aggregation.

  • Buffer optimization: For optimal stability, purified ATP synthase components are typically stored in Tris-based buffers with 50% glycerol .

What structural analysis techniques are most effective for studying ATP synthase subunits?

Multiple complementary techniques have proven valuable for studying ATP synthase structure:

  • Cryo-electron microscopy (cryo-EM): This has become the method of choice for determining the structure of intact ATP synthase complexes, allowing visualization of different rotational states, as demonstrated with Bacillus PS3 ATP synthase . It is particularly valuable for membrane proteins.

  • X-ray crystallography: While challenging for the entire complex, this technique has been successful for determining high-resolution structures of the F₁ region and individual subunits .

  • Focused refinement methods: For ATP synthase, specialized image processing approaches like focused refinement of specific regions (F₀ region, peripheral stalk) can improve resolution for parts of the complex .

  • Cross-linking mass spectrometry: This provides information about subunit interactions and spatial relationships within the complex.

TechniqueAdvantagesLimitationsResolution Range
Cryo-EMCan visualize intact complex; captures different conformational statesRequires specialized equipment2.5-4.0 Å
X-ray crystallographyHigher resolution possibleDifficult for membrane proteins; requires crystals1.5-3.0 Å
NMR spectroscopyGood for dynamic informationLimited to smaller proteins/domainsVariable
Mass spectrometryIdentifies interactions; no size limitIndirect structural informationN/A

How can the functional activity of recombinant ATP synthase subunits be assessed?

Assessing the functional activity of ATP synthase subunits involves several approaches:

  • ATP synthesis/hydrolysis assays: For reconstituted complexes, ATP synthesis can be measured using luciferase-based luminescence assays. ATP hydrolysis can be measured by phosphate release assays.

  • Proton pumping assays: When reconstituted into liposomes, proton pumping activity can be measured using pH-sensitive fluorescent dyes.

  • Binding assays: For individual subunits, binding to partner subunits can be assessed using techniques like surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC).

  • Reconstitution experiments: For subunit a specifically, functionality is often assessed by reconstituting it with other F₀ components and measuring proton translocation or ATP synthesis activities.

  • Complementation assays: Expressing the recombinant protein in ATP synthase-deficient bacterial strains can demonstrate functional complementation.

Studies with Bacillus PS3 ATP synthase in liposomes have shown that proton translocation can be driven by either ΔpH or ΔΨ alone , providing a framework for functional assays with recombinant B. pennsylvanicus components.

What are the optimal storage conditions for maintaining the stability of recombinant ATP synthase subunits?

Based on information for other ATP synthase components, the following storage conditions are recommended:

  • Buffer composition: Tris-based buffers with 50% glycerol are typically used to stabilize the protein structure .

  • Temperature: For extended storage, -20°C or -80°C is recommended , with -80°C preferred for longer-term storage.

  • Working aliquots: Store working aliquots at 4°C for up to one week to avoid repeated freeze-thaw cycles .

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and aggregation .

  • Detergent considerations: For membrane proteins like subunit a, maintaining an appropriate detergent concentration is critical for stability.

For recombinant B. pennsylvanicus ATP synthase subunits, these general principles should be applied and optimized based on empirical testing of protein stability.

How can the structural integrity of recombinant ATP synthase subunits be assessed?

Several techniques can be used to evaluate the structural integrity of recombinant ATP synthase subunits:

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure content and can be used to monitor thermal stability.

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can indicate changes in tertiary structure.

  • Size exclusion chromatography: Can detect aggregation or oligomerization.

  • Limited proteolysis: Properly folded proteins often show distinctive proteolytic patterns.

  • Thermal shift assays: Measure protein stability under different buffer conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.