Recombinant Blochmannia pennsylvanicus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
atpF; BPEN_004; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Blochmannia pennsylvanicus (strain BPEN)
Target Names
atpF
Target Protein Sequence
MNLNATILGQTISFVLFVWFCMKYVWYPFISIIEKRQKEISDNLVSATHAKTESERVNAE ALLCLRQARVKAQEIIKQANKCKMQIINEAKHEAEKEQSRILSQAREQIIYERKRVTDEL RKQISELVIEGTEKVIEHSINEMIDIDLLNNIINTLSYKD
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, linked by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel and forms part of the peripheral stalk, connecting F(1) and F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • How do transcriptional modifications affect atpF expression in Blochmannia pennsylvanicus?

    Transcriptional modifications in B. pennsylvanicus atpF may include:

    • Transcriptional slippage (TS): Similar to what has been observed in other endosymbiotic bacteria, B. pennsylvanicus exhibits TS, particularly at homopolymeric tracts . This process can produce transcript variants with nucleotide insertions or deletions.

    • RNA editing: While not directly observed in atpF of B. pennsylvanicus, RNA editing mechanisms have been reported in related endosymbionts and could potentially affect atpF transcripts .

    The table below shows observed patterns in related systems:

    OrganismGenePositionModification Type
    B. pennsylvanicusatpF51307CCA → CUA
    Other endosymbiontsVariousPoly(A/T) tractsInsertion/Deletion

    These modifications can significantly impact protein expression and function, potentially contributing to the adaptability of the endosymbiont in different host environments .

  • What are the evolutionary implications of amino acid substitution patterns in Blochmannia pennsylvanicus atpF?

    The evolutionary patterns in B. pennsylvanicus atpF reflect the specialized lifestyle of this endosymbiont:

    • Nonsynonymous divergence (dN) between B. pennsylvanicus and B. floridanus is relatively low (average of 0.3012 ± 0.14)

    • Synonymous divergence (dS) exceeds 2 for each gene

    • The dN/dS ratio is below 0.13, indicating strong purifying selection despite genome reduction

    These patterns suggest that despite the streamlined genome of Blochmannia, atpF remains under functional constraint. The accelerated amino acid substitution rates (10-50 fold faster than free-living bacteria) may reflect adaptation to the specialized endosymbiotic niche rather than relaxed selection . This evolutionary trajectory provides insights into how endosymbionts maintain essential functions while undergoing genome reduction.

  • How does the host ant's demography influence selection pressure on Blochmannia pennsylvanicus atpF?

    Research suggests that host demography is associated with shifts toward increased selection strengths in Blochmannia genes, including potentially atpF . The relationship between carpenter ant population dynamics and selection pressures on endosymbiont genes reveals a complex co-evolutionary process. Factors influencing this relationship include:

    • Colony size and structure

    • Geographic distribution of host species

    • Host nutritional requirements

    • Environmental conditions

    Testing these relationships requires integrated approaches combining population genetics, genomics, and ecological data . Understanding these dynamics could explain the varying selection pressures observed across different Blochmannia-ant systems.

Methodological Questions

  • What expression systems are optimal for producing recombinant B. pennsylvanicus atpF?

    Based on available research, E. coli is the predominant expression system for recombinant B. pennsylvanicus atpF production . The recommended methodology includes:

    1. Vector selection: Vectors containing N-terminal His-tags facilitate purification

    2. Expression conditions:

      • Induction with IPTG at OD600 of 0.6-0.8

      • Expression at 30°C for 4-6 hours or 18°C overnight

      • Supplementation with additional factors if necessary for proper folding

    3. Purification strategy:

      • Lysis in Tris/PBS-based buffer

      • IMAC purification using Ni-NTA columns

      • Size exclusion chromatography for increased purity

    The protein is typically recovered as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C .

  • What are the best approaches for functional characterization of recombinant B. pennsylvanicus atpF?

    Functional characterization of recombinant B. pennsylvanicus atpF can be achieved through multiple complementary approaches:

    1. Biochemical assays:

      • ATPase activity assays using colorimetric phosphate detection

      • Proton pumping assays with pH-sensitive fluorescent dyes

      • Reconstitution into liposomes to assess membrane integration

    2. Structural studies:

      • Circular dichroism to assess secondary structure

      • Protein crosslinking to analyze oligomeric states

      • Cryo-EM for structural determination in the context of the ATP synthase complex

    3. Interaction studies:

      • Pull-down assays to identify binding partners

      • Surface plasmon resonance for binding kinetics

      • Yeast two-hybrid or bacterial two-hybrid systems for in vivo interactions

    For each approach, comparison with related proteins from B. floridanus or other endosymbionts can provide valuable insights into functional conservation and divergence .

  • How can researchers isolate native B. pennsylvanicus atpF from ant hosts for comparative studies?

    Isolation of native B. pennsylvanicus from ant hosts is challenging but can be achieved through the following protocol:

    1. Sample collection and preparation:

      • Collect Camponotus pennsylvanicus specimens

      • Dissect midgut tissue where bacteriocytes are concentrated

      • Homogenize tissue in appropriate buffer (e.g., PBS with protease inhibitors)

    2. Bacteriocyte isolation:

      • Density gradient centrifugation to separate bacteriocytes

      • Differential centrifugation to pellet bacterial cells

      • Alternative approach: FACS sorting if fluorescent markers are available

    3. Protein extraction:

      • Gentle lysis of bacterial cells

      • Membrane protein extraction using detergents (e.g., DDM, CHAPS)

      • Enrichment of ATP synthase complex by blue native PAGE

    4. Analysis:

      • Western blotting using antibodies raised against recombinant atpF

      • Mass spectrometry for protein identification and PTM analysis

      • Activity assays compared to recombinant protein

    This approach allows direct comparison between native and recombinant proteins to assess potential post-translational modifications or structural differences .

Analytical Questions

  • How do frameshifts and mutations in atpF affect ATP synthase function in B. pennsylvanicus?

    Frameshifts and mutations in atpF can significantly impact ATP synthase function in B. pennsylvanicus:

    1. Effects of frameshifts:

      • Premature termination of translation

      • Production of truncated proteins

      • Altered C-terminal sequences

    2. Impact on function:

      • Disruption of interactions with other ATP synthase subunits

      • Impaired proton translocation

      • Reduced ATP synthesis efficiency

    Interestingly, some indels in B. pennsylvanicus genes occur within 9-11 bp strings of consecutive As, suggesting that poly(A) tracts may be hotspots for mutations due to AT mutational bias and reduced selective pressure . Despite these mutations, many truncated genes in B. pennsylvanicus appear to encode functional proteins, as evidenced by nonsynonymous divergence (dN) between B. pennsylvanicus and B. floridanus remaining relatively low at these loci .

  • What are the comparative structural differences between B. pennsylvanicus atpF and related proteins from other bacterial species?

    Structural analysis reveals several key differences between B. pennsylvanicus atpF and related proteins:

    FeatureB. pennsylvanicus atpFB. floridanus atpFBacillus pumilus atpFT. whipplei atpF
    Length160 amino acidsSimilar to B. pennsylvanicus170 amino acids172 amino acids
    Sequence identity100% (reference)High (>90%)Low (<40%)Low (<30%)
    Transmembrane regions1 N-terminal regionSimilar to B. pennsylvanicus1 N-terminal region1 N-terminal region
    C-terminal domainHydrophilicSimilar to B. pennsylvanicusMore extendedDifferent charge distribution
    AA sequenceMNLNATILGQTISFV...Highly similarMSQLPVVLGAGLNTG...MKFAQPHNPLLPSV...

    The amino acid sequence of B. pennsylvanicus atpF shows high conservation with B. floridanus but diverges significantly from non-endosymbiotic bacteria . These structural differences likely reflect adaptation to the specific environment within ant bacteriocytes and the energetic requirements of the endosymbiotic lifestyle.

  • How do environmental factors influence the expression and function of B. pennsylvanicus atpF in the ant host?

    Environmental factors significantly impact the expression and function of B. pennsylvanicus atpF within the ant host:

    1. Host nutritional status:

      • Dietary nitrogen availability influences endosymbiont metabolism

      • Carbon source variation affects energy production requirements

      • Amino acid availability may regulate ATP synthase expression

    2. Temperature fluctuations:

      • Seasonal temperature changes alter metabolic demands

      • Heat stress may induce chaperon-mediated ATP synthase assembly

      • Cold temperatures may require modifications in membrane fluidity affecting F0 sector function

    3. Host developmental stage:

      • Larval stages may have different energetic requirements than adults

      • Colony founding phase may impose different metabolic demands

      • Reproductive ants may modulate endosymbiont energy production

    Research approaches to study these influences include controlled diet experiments with ant colonies, temperature manipulation studies, and transcriptomic/proteomic profiling across different host life stages . Understanding these environmental effects provides insights into the adaptive mechanisms that maintain this long-term symbiotic relationship.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.