Recombinant Blochmannia pennsylvanicus Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

The recombinant protein is produced in Escherichia coli with an N-terminal His-tag for affinity purification .

ParameterSpecification
Host SystemE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; 50% glycerol for long-term storage at -80°C
UniProt IDQ492S9

Biochemical Properties

  • Thermostability: Requires storage at -20°C/-80°C; repeated freeze-thaw cycles degrade activity .

  • Functional Validation: ATPase activity assays confirm energy-dependent lipid A flipping .

Thermodynamic Mutant Cycle Analysis (Homolog Data) :

MutationImpact on Lipid A Binding
R78ADisrupts phosphoglucosamine coordination (ΔΔG +5 kJ/mol)
R188A/R238AWeakens exterior site binding (ΔΔH -57 kJ/mol)
K299AReduces interior site affinity (ΔΔG +3 kJ/mol)

Research Applications

  • Antimicrobial Development: Target for inhibitors disrupting lipid A transport (e.g., quinoline-based compounds) .

  • Structural Biology: Cryo-EM and X-ray crystallography reveal conformational states for drug design .

  • Biosensor Integration: Supported lipid bilayers (SLBs) enable real-time monitoring of ATPase activity .

Comparative Analysis with Other MsbA Orthologs

SpeciesProtein LengthKey Functional Difference
B. pennsylvanicus584 residuesFull-length construct optimized for in vitro studies
Pseudomonas fluorescens601 residuesExtended C-terminal region for substrate recognition
E. coli582 residuesWider NBD separation in apo state

Challenges and Future Directions

  • Species-Specific Studies: Functional data for B. pennsylvanicus MsbA remain sparse; homology modeling is currently relied upon.

  • Inhibitor Specificity: Developing compounds targeting B. pennsylvanicus MsbA requires high-resolution co-crystal structures .

This recombinant protein serves as a critical tool for dissecting lipid A transport mechanisms and advancing antimicrobial strategies against Gram-negative pathogens .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize development accordingly.
Synonyms
msbA; BPEN_390; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-584
Protein Length
full length protein
Species
Blochmannia pennsylvanicus (strain BPEN)
Target Names
msbA
Target Protein Sequence
MLQYNKNHSSTWQTFRRLWPIIFPFRVGLVVASITLILNATSDALMLALLKPLLDDGFGK ANRDVFVWMPLALVGLMGIRGFSGFASTYCISWVSGKVVMQMRRALFKHIMNMPVSFFVK QSTGTLVSRITYDSDQVASSSSGALVTVIREGASIIGLCIMMFYYSWQLSLILVLIAPIV SITIKLVSHRFRTISKKMQSAMGQLTSSAEQMLQGHKEVLIFGGQHTEKDRFNCVSNRMR QQSMKMVQTSSIFDPLIQCVASLALAFVLYAASIPSVMEMLTAGTITVIFSSMIVLMKPL KSLTNVSAQFQRGMAACQTLFSILDLETEKDQGILDITRVQGHIIFDDVTFFYPEKNTPS LYKINFSIESGKTVALVGRSGSGKSTIVNLLTRFYDIDKGRILLDGFNLNDYKLASLRNQ IAMVSQNVHLFNDTIANNIAYARRNFYSRESIETAARMACAMDFISQMKNGLDTIIGENG ILLSSGQRQRIAIARALLRDCPILIFDEATSALDSASEHIIHKSLDTLKKNRTSLIIAHR LSTVENADEILVIENGYIMERGVHKVLIRRQGIYAQLYKLQFSS
Uniprot No.

Target Background

Function

This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates the lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.

Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MsbA in Blochmannia pennsylvanicus?

MsbA in Blochmannia pennsylvanicus functions as a lipid flippase that transports lipid A and potentially lipopolysaccharide (LPS) from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane. This function is essential in gram-negative bacteria as demonstrated in related bacterial systems . The protein belongs to the ATP-binding cassette (ABC) transporter family, which uses energy from ATP hydrolysis to drive substrate transport. In the context of B. pennsylvanicus's endosymbiotic lifestyle, MsbA's role is particularly important as this bacterium retains numerous genes involved in cell wall and membrane component biosynthesis, including those for peptidoglycan and isoprenoids . The transport of lipid A is a crucial step in the biogenesis of the outer membrane, which serves as a protective barrier for this endosymbiont residing within ant cells.

How does the structure of MsbA in B. pennsylvanicus compare to homologs in other bacterial species?

While the specific structure of B. pennsylvanicus MsbA has not been directly determined, insights can be gained from structural studies of homologous proteins. MsbA from Salmonella typhimurium has been resolved at 2.8 Å resolution in an inward-facing conformation, revealing a large amplitude opening in the transmembrane portal that allows lipid A to enter the transport pathway . B. pennsylvanicus MsbA likely shares key structural features with other bacterial MsbA proteins, including a transmembrane domain (TMD) that forms the substrate passage and a nucleotide-binding domain (NBD) that binds and hydrolyzes ATP. The protein would be expected to undergo conformational changes during the transport cycle, transitioning between inward-facing, outward-facing, and intermediate states. Unlike free-living bacteria, B. pennsylvanicus has experienced genome reduction and increased evolutionary rates of amino acid substitutions, which may have led to structural adaptations in MsbA to accommodate the endosymbiotic lifestyle .

What expression systems are most effective for producing recombinant B. pennsylvanicus MsbA?

Expression of membrane proteins like MsbA presents significant challenges due to their hydrophobic nature and complex folding requirements. For B. pennsylvanicus MsbA, E. coli-based expression systems modified for membrane protein production represent the most practical approach. The BL21(DE3) strain with codon optimization for the AT-rich B. pennsylvanicus genome is recommended, as the endosymbiont genome has a strong AT bias that would otherwise limit expression efficiency in E. coli. Expression should be conducted at lower temperatures (16-20°C) to reduce inclusion body formation and improve proper folding. Induction with low IPTG concentrations (0.1-0.5 mM) is advised to prevent overwhelming the host's membrane insertion machinery. For purification, stabilizing the protein with facial amphiphiles similar to those used for S. typhimurium MsbA has proven effective . Alternative expression systems like insect cells or cell-free systems may be considered for cases where E. coli expression yields inadequate results or inappropriate folding.

How has the endosymbiotic lifestyle of B. pennsylvanicus influenced MsbA evolution?

The endosymbiotic lifestyle of B. pennsylvanicus has driven significant evolutionary changes in its genome, including the MsbA gene. Genome sequence analysis reveals that B. pennsylvanicus has experienced 10- to 50-fold faster amino acid substitution rates compared to free-living bacteria, though essential genes typically show lower nonsynonymous divergence (dN) than synonymous divergence (dS) . As an obligate endosymbiont, B. pennsylvanicus has undergone genome reduction while maintaining genes critical for cell viability and symbiotic function. The MsbA protein has likely been retained due to its essential role in membrane biogenesis. The AT-rich genome context of B. pennsylvanicus may have influenced codon usage in the msbA gene, potentially affecting translation efficiency. Additionally, the specialized environment within ant cells may have driven adaptive changes in MsbA substrate specificity or regulatory mechanisms compared to free-living bacteria.

What structural adaptations might MsbA have evolved to function optimally in the B. pennsylvanicus endosymbiotic environment?

MsbA in B. pennsylvanicus has likely evolved specific structural adaptations to function in the unique endosymbiotic environment. Given the extreme stasis observed in genome architecture among insect endosymbionts, conserved gene order suggests functional constraints on protein interactions and expression patterns . The transmembrane domains may have adapted to the different membrane composition of B. pennsylvanicus, which retains pathways for isoprenoid biosynthesis not found in B. floridanus . The ATP-binding pocket might show modifications reflecting the potentially different energetic environment within the host cell. The substrate-binding cavity could have evolved specificity for the particular lipid A variants produced by B. pennsylvanicus. Comparative structural modeling with homologs from related species would reveal conserved regions likely critical for function versus variable regions that might represent adaptive changes. Additionally, potential interaction sites with host proteins might have evolved as part of the intimate host-symbiont relationship.

How do mutations in the ATP-binding domain affect MsbA function in B. pennsylvanicus?

Mutations in the ATP-binding domain of MsbA would significantly impact its function through several mechanisms. The Walker A motif (P-loop) mutations, particularly in the conserved lysine residue, would abolish ATP binding and subsequent hydrolysis, rendering the transporter inactive. Mutations in the Walker B motif would impair ATP hydrolysis without necessarily affecting binding, potentially trapping the transporter in an ATP-bound conformation. The signature motif (LSGGQ) mutations would disrupt the cooperative interaction between the two NBDs, preventing the formation of the sandwich dimer necessary for ATP hydrolysis. Mutations in the Q-loop would affect communication between the ATP-binding site and the transmembrane domain, uncoupling ATP hydrolysis from conformational changes required for transport. D-loop mutations would disrupt the dimeric interface between NBDs, reducing transporter efficiency. These effects would be particularly detrimental in B. pennsylvanicus due to its obligate endosymbiotic lifestyle and reduced genetic redundancy compared to free-living bacteria .

What are optimal protocols for purifying recombinant B. pennsylvanicus MsbA while maintaining its activity?

The purification of active recombinant B. pennsylvanicus MsbA requires careful consideration of detergent selection and buffer composition. Initial solubilization should employ mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration. Inclusion of facial amphiphiles, as used successfully with S. typhimurium MsbA, stabilizes the protein during extraction and purification . A two-step purification approach is recommended, beginning with immobilized metal affinity chromatography (IMAC) using a C-terminal His-tag, followed by size exclusion chromatography (SEC) to remove aggregates and achieve high purity. Throughout purification, maintaining a consistent detergent concentration above CMC is critical to prevent protein aggregation. Buffer composition should include 20-50 mM Tris-HCl or HEPES (pH 7.5), 100-300 mM NaCl, 10% glycerol as a stabilizer, and 1-5 mM DTT to prevent oxidation of cysteine residues. For activity assays, reconstitution into proteoliposomes using E. coli polar lipids supplemented with phosphatidylcholine provides a membrane environment that supports ATPase activity and lipid flipping.

What approaches can determine if B. pennsylvanicus MsbA interacts with host ant proteins?

Investigating potential interactions between B. pennsylvanicus MsbA and host ant proteins requires multiple complementary approaches due to the complexity of studying an obligate endosymbiont. Co-immunoprecipitation (Co-IP) represents a foundational approach, using antibodies against either MsbA or candidate host proteins to pull down potential interaction partners. Pull-down assays with recombinant MsbA containing affinity tags can capture interacting host proteins from ant cell lysates. Proximity labeling methods such as BioID or APEX can identify proteins in close proximity to MsbA within intact endosymbionts, offering advantages for detecting transient interactions. Yeast two-hybrid or bacterial two-hybrid screens using the cytoplasmic domains of MsbA as bait can identify potential interacting partners from ant protein libraries. Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) can visualize interactions in reconstituted systems. Mass spectrometry-based interactomics with chemical crosslinking can capture the interaction landscape around MsbA. For validation, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can quantify binding affinities and thermodynamic parameters of confirmed interactions.

How can researchers distinguish between direct effects of MsbA inhibition and secondary metabolic changes?

Distinguishing direct from indirect effects of MsbA inhibition requires a multi-faceted experimental approach with appropriate controls. Site-directed mutagenesis of key residues in the ATP-binding domain or substrate-binding pocket can create variants with specific functional deficiencies without disrupting protein expression or folding. Comparing these variants to wild-type MsbA allows researchers to attribute observed phenotypes to specific MsbA functions. Genetic complementation studies, where mutant phenotypes are rescued by expression of functional MsbA, confirm the specificity of observed effects. Time-course experiments can help distinguish primary from secondary effects, as direct consequences of MsbA inhibition should manifest more rapidly than downstream metabolic adaptations. Metabolomic profiling before and after MsbA inhibition can track changes in lipid A and LPS intermediates directly linked to MsbA function, while also monitoring broader metabolic shifts. Specific biochemical assays measuring ATP hydrolysis, lipid flipping, and lipid A transport provide direct measures of MsbA activity that can be correlated with observed phenotypes. Systems biology approaches integrating transcriptomic, proteomic, and metabolomic data can help map the cascade of effects following MsbA inhibition and identify direct versus indirect consequences.

What are common pitfalls in functional assays for recombinant B. pennsylvanicus MsbA?

Functional characterization of recombinant B. pennsylvanicus MsbA faces several challenges that researchers should anticipate. ATPase activity assays may show high background due to contaminating ATPases, requiring rigorous purification and appropriate negative controls using ATP-binding site mutants. Substrate specificity determination is complicated by the diversity of potential lipid A structures and the difficulty in obtaining pure, labeled substrates specific to B. pennsylvanicus. Transport assays in reconstituted proteoliposomes may suffer from inconsistent incorporation of MsbA or leaky vesicles, necessitating careful quality control of proteoliposome preparation. Detergent selection significantly impacts protein stability and activity, with sub-optimal detergents leading to protein aggregation or inactivation. The AT-rich genome of B. pennsylvanicus presents codon usage challenges in heterologous expression systems, potentially requiring codon optimization for efficient expression . Membrane protein crystallization for structural studies remains difficult despite advances in techniques.

How can researchers overcome solubility and stability issues with recombinant B. pennsylvanicus MsbA?

Addressing solubility and stability challenges with recombinant B. pennsylvanicus MsbA requires systematic optimization at multiple stages of the experimental workflow. During expression, using specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein overexpression can improve yields and proper folding. Fusion partners such as maltose-binding protein (MBP) or novel partners like mistic can enhance solubility and membrane targeting. Expression at lower temperatures (16-20°C) with reduced inducer concentrations promotes proper folding over rapid accumulation. For extraction and purification, screening multiple detergents is essential, with newer detergents like glyco-diosgenin (GDN) or neopentyl glycol-based detergents often providing better stability than traditional options. Supplementing buffers with specific lipids found in bacterial membranes can stabilize the native conformation. Nanodiscs or styrene-maleic acid lipid particles (SMALPs) offer detergent-free alternatives for maintaining MsbA in a lipid environment. For long-term stability, addition of cholesterol hemisuccinate or specific lipid mixtures can significantly extend protein shelf-life. Thermal stability assays using differential scanning fluorimetry help identify optimal buffer compositions and additives for maximum stability.

What are appropriate controls for studying B. pennsylvanicus MsbA in the context of ant-bacterial symbiosis?

Designing appropriate controls for studying B. pennsylvanicus MsbA in ant-bacterial symbiosis requires careful consideration of both the molecular and ecological contexts. At the molecular level, site-directed mutants with specifically altered functions (e.g., Walker A lysine mutants) serve as negative controls for ATPase activity while maintaining protein expression. Comparison with MsbA from free-living relatives provides evolutionary context for functional adaptations. For in vivo studies, antibiotic treatments to reduce Blochmannia levels must be carefully controlled, as they may have unintended effects on host physiology or other microbiota . Cross-fostering experiments between antibiotic-treated and untreated colonies help distinguish bacterial effects from host genetic factors. Age-matched worker ants and standardized colony sizes minimize variation in social factors that might influence symbiont dynamics. Quantification of Blochmannia titers using qPCR confirms the effectiveness of experimental manipulations targeting the symbiont. Time-course sampling distinguishes immediate effects of MsbA perturbation from long-term adaptations in the symbiosis. Including multiple Camponotus species with different dependencies on Blochmannia provides evolutionary context for the symbiotic relationship.

How might comparative studies of MsbA across different Blochmannia species inform symbiosis evolution?

Comparative studies of MsbA across Blochmannia species offer valuable insights into the co-evolution of endosymbionts with their ant hosts. Sequence analysis across Blochmannia species can reveal patterns of selection pressure on different domains of MsbA, identifying conserved regions critical for function versus variable regions that might represent host-specific adaptations. Differences in MsbA structure and function between B. pennsylvanicus and B. floridanus could illuminate how these symbionts have adapted to their specific host environments, particularly given the differential retention of genes involved in cell wall and membrane component synthesis between these species . The extreme stasis in genome architecture observed in Blochmannia suggests functional constraints that likely extend to MsbA's role in membrane biogenesis . Experimental approaches comparing lipid A structures and MsbA substrate specificity across Blochmannia species could reveal how the transporter has co-evolved with its substrate. Correlation between MsbA sequence variations and host ant phylogeny would provide evidence for co-speciation and co-adaptation in this symbiotic system.

What role might MsbA inhibition play in the cost-benefit balance of the ant-Blochmannia symbiosis?

Recent findings suggest a nuanced cost-benefit relationship in the ant-Blochmannia symbiosis, where symbiont-free workers showed improved brood-rearing success despite reduced development of eggs into adults . This presents intriguing questions about MsbA's potential role in this balance. As a critical transporter for outer membrane biogenesis, MsbA function directly impacts the integrity of the bacterial cell envelope, which in turn affects how the symbiont interacts with host cells. Selective inhibition of MsbA could potentially modulate rather than eliminate the symbiosis, allowing researchers to fine-tune the cost-benefit balance. Lipid A structural variations resulting from altered MsbA function might change how the host immune system recognizes the symbiont, potentially reducing maintenance costs. Comparative metabolomic studies between colonies with normal versus inhibited MsbA function could identify specific metabolic exchanges that contribute to both costs and benefits of the symbiosis. Targeted inhibition approaches could help distinguish between essential nutritional benefits provided by the symbiont and potential competitive costs for resources.

What novel experimental systems could advance the study of B. pennsylvanicus MsbA in vitro?

Developing advanced experimental systems for studying B. pennsylvanicus MsbA would overcome significant limitations in current approaches. Cell-free expression systems specifically optimized for membrane proteins offer potential for producing MsbA without the constraints of cellular toxicity or inclusion body formation. Nanodiscs with defined lipid compositions mimicking the B. pennsylvanicus membrane environment would provide a native-like setting for functional studies while maintaining accessibility for biochemical assays. Microfluidic devices could enable single-molecule studies of MsbA conformational changes during the transport cycle. Cryo-electron microscopy, particularly with advances in sample preparation and image processing, presents opportunities for high-resolution structural analysis of MsbA in different conformational states. Development of ant cell culture systems, though technically challenging, would revolutionize the study of host-symbiont interactions in a controlled setting. CRISPR-based approaches for generating conditional MsbA mutants in culturable bacterial models expressing B. pennsylvanicus MsbA could provide insights into function without requiring direct manipulation of the unculturable endosymbiont.

Table 1: Comparison of Key Features Between B. pennsylvanicus and B. floridanus MsbA

FeatureB. pennsylvanicus MsbAB. floridanus MsbANotes
Gene lengthConservedConservedBoth species show conservation in gene order and strand orientation
Evolutionary rateSimilar to other proteinsSimilar to other proteins10-50 fold faster amino acid substitution rates compared to free-living bacteria
Genomic contextRetained cell wall synthesis pathwaysMissing several cell wall synthesis genesB. pennsylvanicus retains pathways for isoprenoid biosynthesis
Predicted substrateLipid ALipid ABased on homology to characterized MsbA proteins
Domain architectureTMD-NBDTMD-NBDConserved architecture of ABC transporters
Functional dependenceEssentialEssentialBased on essential role in membrane biogenesis

Table 2: Recommended Purification Conditions for Recombinant B. pennsylvanicus MsbA

ParameterRecommended ConditionAlternative OptionsRationale
DetergentDDM (0.05%)LMNG (0.01%), GDN (0.02%)Balance between extraction efficiency and protein stability
Buffer20 mM HEPES pH 7.520 mM Tris-HCl pH 7.5Maintains physiological pH while providing good buffering capacity
Salt150 mM NaCl100-300 mM NaClPrevents non-specific interactions while maintaining protein solubility
Stabilizers10% glycerol, 1 mM DTT5-20% glycerol, 5 mM β-mercaptoethanolPrevents aggregation and oxidation
Facial amphiphilesFA-3FA-4, FA-5Demonstrated effectiveness with MsbA homologs
Purification methodIMAC followed by SECAffinity chromatography with MBP tagTwo-step purification ensures high purity
Storage-80°C in 10% glycerol4°C for short-term (1-2 days)Prevents freeze-thaw damage while maintaining activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.