Recombinant Blochmannia pennsylvanicus Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

B. pennsylvanicus LspA is part of the sec-dependent secretory pathway retained in this endosymbiont, distinguishing it from other insect mutualists that have lost this system . Its functions include:

  • Lipoprotein Processing: Cleaving signal peptides from prolipoproteins, enabling their integration into the cell membrane .

  • Cell Envelope Integrity: Contributing to peptidoglycan synthesis and stress response via interactions with chaperonins like SecB and DsbA .

Metabolic Context:

PathwayRole of LspA in B. pennsylvanicusGenomic Retention Status
Lipoprotein processingSignal peptide cleavageRetained (lspA gene intact)
Peptidoglycan synthesisSupports murein biosynthesis enzymesRetained (murI, coaADE genes)
Isoprenoid biosynthesisProvides substrates for cell wall assemblyRetained (complete pathway)

Biochemical Properties:

  • Expression System: E. coli (codon-optimized for heterologous expression)

  • Purity: >95% (SDS-PAGE verified)

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C or -80°C .

Research Applications and Antibiotic Resistance Insights

Studies on LspA homologs (e.g., in Staphylococcus aureus) reveal its broader relevance:

  • β-Lactam Resistance: Mutations in lspA increase methicillin resistance in MRSA by altering cell envelope dynamics, independent of PBP2a expression .

  • Drug Target Potential: Globomycin’s inhibition of LspA highlights its utility in developing antibiotics targeting lipoprotein processing .

Genomic and Evolutionary Context

B. pennsylvanicus retains a 791.5 kb genome (GenBank: CP000016) with low pseudogene content compared to related symbionts like B. floridanus . Key genomic features:

  • Conserved Pathways: Full sec-dependent secretion system, peptidoglycan biosynthesis, and coenzyme A synthesis .

  • Divergence: Synonymous substitution rates (dS) >2 in shared genes with B. floridanus, indicating strong purifying selection .

Future Directions

Research on recombinant B. pennsylvanicus LspA could advance:

  • Structural Biology: High-resolution crystallography to refine inhibition mechanisms.

  • Antibiotic Development: Screening for globomycin analogs with improved pharmacokinetics .

  • Symbiosis Studies: Elucidating lipoprotein trafficking in host-endosymbiont interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; BPEN_123; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Blochmannia pennsylvanicus (strain BPEN)
Target Names
lspA
Target Protein Sequence
MNNKYNYKNLKWLWLSILIMLLDIGTKYWVKTHFWIGEVLSVLPGINCYYVCNPGLAFGL FTNASLYYRWLFVWIITLVIVAFIIALYKLIERPKCYSISYSMVIGGALGNLLDRILYGA VVDFIDVHIKNWHWPTFNVADIAICIGITIVTIRFYYDFIKNNLY
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Blochmannia pennsylvanicus Lipoprotein signal peptidase (lspA) and what are its fundamental functions?

Blochmannia pennsylvanicus Lipoprotein signal peptidase (lspA), also designated as Signal peptidase II (SPase II), is a membrane-bound enzyme with the EC number 3.4.23.36 that belongs to the class of proteases . This enzyme plays a critical role in the processing of bacterial prolipoproteins, which are essential components of the cell envelope. The primary function of lspA is to cleave the signal peptide from prolipoproteins after they have been modified by the addition of a diacylglycerol moiety, thereby facilitating the proper localization and anchoring of lipoproteins in the bacterial cell membrane .

In the context of Blochmannia pennsylvanicus, an obligate endosymbiont of the ant Camponotus pennsylvanicus, lspA holds particular significance as it contributes to the maintenance of the bacterial cell membrane integrity . The proper functioning of this membrane is crucial for the endosymbiotic relationship between the bacterium and its host ant. The lspA gene is listed among the ordered locus names as BPEN_123, indicating its position in the compact 792-kb genome of B. pennsylvanicus .

Unlike many other genes that have been lost during the reductive evolution of endosymbiont genomes, lspA has been retained in Blochmannia pennsylvanicus, suggesting its essential nature for bacterial survival and symbiotic interactions. This retention aligns with observations that genes involved in membrane functions are often preserved in obligate endosymbionts despite extensive genome reduction .

How should researchers handle and store Recombinant Blochmannia pennsylvanicus lspA for optimal stability?

Proper handling and storage of Recombinant Blochmannia pennsylvanicus Lipoprotein signal peptidase are crucial for maintaining protein integrity and enzymatic activity. Based on standard protocols for similar recombinant proteins, the following guidelines should be implemented in research settings:

The recombinant lspA protein is typically supplied in a stabilizing buffer containing Tris and 50% glycerol, which has been optimized specifically for this protein . For short-term storage (up to one week), working aliquots should be maintained at 4°C to minimize freeze-thaw cycles while preserving activity . For extended storage periods, the protein should be kept at -20°C, with -80°C being preferable for long-term archiving to prevent degradation and preserve functional integrity .

Repeated freezing and thawing cycles should be strictly avoided as they can lead to protein denaturation and loss of enzymatic activity . To mitigate this risk, researchers should divide the stock solution into small working aliquots upon receipt. Each aliquot should contain only the amount needed for a single set of experiments, typically 5-10 μg depending on the specific application.

When handling the protein, it is advisable to work in a temperature-controlled environment (4-8°C when possible) and use pre-chilled pipette tips and microcentrifuge tubes to minimize thermal stress. Additionally, exposure to extreme pH conditions should be avoided, as membrane proteins like lspA are particularly sensitive to pH fluctuations that can disrupt their native conformation and catalytic properties.

For experimental protocols requiring buffer exchange, gradual dialysis is recommended over rapid dilution to prevent protein aggregation or precipitation. If concentration is necessary, centrifugal filter devices with appropriate molecular weight cut-offs (typically 10 kDa for lspA) should be used at moderate centrifugal forces and low temperatures.

What experimental systems can be used to study lspA function in Blochmannia pennsylvanicus?

Heterologous expression systems represent a primary approach for studying lspA function. The gene can be cloned and expressed in model organisms such as Escherichia coli using vectors that contain appropriate promoters and fusion tags to facilitate protein purification . The recombinant protein can then be isolated using affinity chromatography techniques based on the incorporated tags (such as His-tag) . This approach enables researchers to obtain sufficient quantities of the protein for biochemical and structural studies, despite the challenges of culturing the original endosymbiont.

In vitro enzymatic assays can be developed to assess the proteolytic activity of purified recombinant lspA. These typically involve synthetic peptide substrates that mimic the cleavage site of natural prolipoproteins, coupled with detection methods such as fluorescence or chromatography to monitor the cleavage products. Such assays can provide valuable information about substrate specificity, kinetic parameters, and the effects of potential inhibitors on enzyme activity.

Comparative genomic and proteomic approaches offer another avenue for studying lspA function. By comparing the gene sequence, expression patterns, and protein interactions across different Blochmannia strains (such as B. pennsylvanicus and B. floridanus), researchers can gain insights into the evolutionary conservation and functional importance of lspA in these endosymbionts . Techniques such as RNA-Seq and mass spectrometry-based proteomics can be employed to identify potential lipoprotein substrates processed by lspA.

Microscopy-based techniques, including immunofluorescence and electron microscopy with immunogold labeling, can be used to localize lspA within bacterial cells and potentially visualize its association with the membrane and other cellular components. These approaches require the development of specific antibodies against the lspA protein, which can be generated using purified recombinant protein as an antigen.

How does the evolutionary rate of Blochmannia pennsylvanicus lspA compare to orthologous genes in related bacterial species?

The evolutionary dynamics of Blochmannia pennsylvanicus lspA present a fascinating case study in molecular evolution within the context of endosymbiosis. Genome-wide analyses have revealed that Blochmannia species exhibit 10- to 50-fold faster amino acid substitution rates compared to their free-living bacterial relatives . This accelerated evolutionary rate is characteristic of obligate endosymbionts and reflects the distinct selective pressures and population dynamics experienced in the intracellular environment.

The relatively moderate protein divergence of lspA between the two Blochmannia species (with an average divergence value comparable to the genome-wide average of approximately 0.565 ±0.309) further suggests that functional constraints have conserved the protein's structure and activity . This pattern contrasts with some other genes in the Blochmannia genome that show extreme divergence or have been lost entirely from one of the species, highlighting the critical nature of lspA's function.

Interestingly, while sequence evolution proceeds rapidly in Blochmannia, the genomic architecture shows remarkable stability. The two Blochmannia species exhibit complete conservation in the order and strand orientation of shared genes, including lspA . This extreme stasis in genome architecture is also observed in other insect endosymbionts like Buchnera and appears to be a characteristic feature of long-term bacterial mutualists of insects .

The table below summarizes the evolutionary parameters for lspA compared to the genome-wide averages in Blochmannia:

Evolutionary ParameterlspA ValueGenome-wide AverageInterpretation
Nonsynonymous divergence (dN)~0.3012 ±0.14VariableModerate protein sequence change
Synonymous divergence (dS)>2Often saturatedExpected for long-term divergence
dN/dS ratio<0.13VariableStrong purifying selection
Protein divergence~0.5650.565 ±0.309Typical divergence rate for this genus
Gene order conservationCompleteCompleteExtreme genomic stasis

What role does lspA play in membrane maintenance compared between Blochmannia pennsylvanicus and Blochmannia floridanus?

Blochmannia pennsylvanicus possesses a more comprehensive set of genes involved in cell wall and membrane biosynthesis and maintenance compared to B. floridanus. B. pennsylvanicus retains six distinct ORFs that contribute to the de novo synthesis of peptidoglycan (murein), the major constituent of Gram-negative bacterial cell walls . Additionally, it maintains the complete pathway for the biosynthesis of isoprenoids, which are essential substrates for the synthesis of peptidoglycan and various organic compounds including carotinoids, glycosyl carrier lipids, and ubiquinone side chains .

In contrast, B. floridanus shows gene loss in these pathways, lacking murI and experiencing interruption in isoprenoid biosynthesis . This suggests that B. floridanus may rely more heavily on host-derived components or alternate biosynthetic routes for cell wall maintenance. Within this context, the retained lspA likely plays an even more crucial role in B. floridanus to ensure proper processing and incorporation of the available lipoproteins into the cell membrane.

B. pennsylvanicus is also the first fully sequenced insect endosymbiont known to retain the entire sec-dependent secretory pathway, including the chaperonin SecB . This complete secretory system likely enhances the efficiency of protein translocation across the membrane, potentially including the proper localization of lipoproteins processed by lspA. B. pennsylvanicus also retains additional periplasmic chaperonins such as LolB and DsbA, which may work in conjunction with lspA to ensure proper transport, localization, and conformation of membrane proteins .

The differences in gene complement suggest that while both species utilize lspA for lipoprotein processing, B. pennsylvanicus may have a more robust and self-sufficient membrane maintenance system. This could reflect different evolutionary trajectories or host-symbiont relationships between the two Blochmannia species, potentially influenced by the specific ecological niches or physiological requirements of their respective ant hosts.

What methods can researchers employ to investigate the substrate specificity of Blochmannia pennsylvanicus lspA?

Investigating the substrate specificity of Blochmannia pennsylvanicus Lipoprotein signal peptidase requires sophisticated biochemical and molecular approaches. Several methodological strategies can be implemented to characterize the enzyme's substrate preferences and catalytic properties in detail.

In vitro enzymatic assays with synthetic peptide libraries represent a powerful approach for defining substrate specificity. Researchers can design a series of peptide substrates that systematically vary the amino acid composition around the cleavage site (particularly the -3 to +2 positions relative to the conserved cysteine in the lipobox). These peptides can be labeled with fluorogenic or chromogenic groups to enable high-throughput screening of cleavage efficiency. Analysis of which peptides serve as effective substrates would reveal the sequence determinants recognized by the B. pennsylvanicus lspA enzyme .

Bioinformatic prediction of potential natural substrates offers a complementary approach. The B. pennsylvanicus genome can be analyzed using specialized algorithms to identify all potential lipoprotein-encoding genes based on the presence of characteristic signal sequences and lipobox motifs . This computational approach can generate a comprehensive list of potential natural substrates for experimental validation.

Proteomic analysis of lipoproteins represents another valuable strategy. Comparative proteomics of membrane fractions from systems expressing active versus inactive lspA (for example, through site-directed mutagenesis of catalytic residues) can identify proteins that accumulate as unprocessed precursors when lspA activity is compromised. Modern mass spectrometry techniques, particularly those optimized for membrane proteins, can provide direct evidence of lspA-mediated cleavage by identifying the N-terminal modifications characteristic of processed bacterial lipoproteins.

Structure-function studies using site-directed mutagenesis offer insights into the catalytic mechanism and substrate recognition. By systematically altering residues in the putative active site and substrate-binding pocket of lspA, researchers can map the contributions of specific amino acids to catalytic efficiency and substrate specificity. This approach requires the expression and purification of mutant variants of the enzyme, followed by activity assays using defined substrates .

Cross-species complementation experiments can reveal evolutionary conservation of substrate recognition. The ability of B. pennsylvanicus lspA to process lipoprotein precursors from other bacterial species (and vice versa) would provide information about the evolutionary plasticity of substrate recognition in this enzyme family. Such experiments could involve heterologous expression of lspA in model organisms lacking their native signal peptidase II activity, followed by assessment of lipoprotein processing.

How might the unique genomic context of Blochmannia pennsylvanicus influence lspA function and evolution?

The genomic context of Blochmannia pennsylvanicus creates a distinctive evolutionary environment that likely shapes the function and evolution of lspA in ways that differ from free-living bacteria. Several aspects of this genomic context merit consideration when analyzing lspA function and evolution.

The extreme genome stability observed in Blochmannia species, with complete conservation of gene order and strand orientation between B. pennsylvanicus and B. floridanus, suggests strong constraints on genomic rearrangements . This genomic stasis, also observed in other insect endosymbionts like Buchnera, might reflect the loss of recombination machinery or selection against rearrangements that could disrupt gene expression patterns . For lspA, this stable genomic context likely ensures consistent expression patterns and potentially co-regulation with functionally related genes involved in membrane biogenesis and maintenance.

The AT-rich composition of the Blochmannia genome creates a distinct mutational landscape. The search results indicate that indels (insertions/deletions) in Blochmannia genes frequently occur within poly(A) tracts, which are very common within the genome (e.g., B. pennsylvanicus has 133 poly(A) or poly(T) tracts >9 bp long) . While lspA itself may be protected from such frameshifts by strong purifying selection, this AT-rich context could influence its codon usage and potentially impact translation efficiency.

The deletion of DnaA in both Blochmannia species suggests alterations in the mechanism of DNA replication initiation . In B. pennsylvanicus, the nucleoprotein Hns might be recruited to the replication origin for this purpose . These adjustments in fundamental cellular processes could indirectly affect lspA expression patterns or create unique selective pressures on genes involved in membrane functions, including lspA.

Differential gene loss between B. pennsylvanicus and B. floridanus, particularly in pathways related to cell wall and membrane components, suggests distinct adaptations in their endosymbiotic relationships . While both species retain lspA, the different complements of genes involved in peptidoglycan synthesis and membrane component production may result in different sets of lipoprotein substrates for lspA, potentially driving subtle adaptations in its substrate specificity or activity.

What approaches can be used to study the interaction between Blochmannia pennsylvanicus lspA and the host ant proteome?

Investigating the potential interactions between Blochmannia pennsylvanicus lspA and the host ant (Camponotus pennsylvanicus) proteome presents significant challenges but can be approached through several innovative methodologies. These interactions could provide crucial insights into the molecular basis of this endosymbiotic relationship.

Co-immunoprecipitation (Co-IP) coupled with mass spectrometry represents a powerful approach for identifying direct protein-protein interactions. Antibodies specific to recombinant B. pennsylvanicus lspA can be used to precipitate the protein from lysates of infected ant tissues, potentially pulling down any associated host proteins . The precipitated complexes can then be analyzed by mass spectrometry to identify the host proteins that interact with lspA. This technique requires careful optimization to preserve weak or transient interactions that might be biologically significant.

Yeast two-hybrid (Y2H) or bacterial two-hybrid screening offers an alternative approach for detecting binary protein interactions. The lspA gene can be cloned into appropriate vectors for expression as a "bait" protein, which can then be screened against a "prey" library derived from ant host tissues . Positive interactions activate reporter genes, allowing for the identification of host proteins that directly interact with lspA. This system is particularly useful for detecting interactions that might occur outside the native membrane environment.

Cross-linking mass spectrometry (XL-MS) can capture transient or weak interactions by covalently linking proteins that are in close proximity before sample preparation. Chemical cross-linkers with various specificities and spacer arm lengths can be applied to intact bacterial cells within host tissues, followed by isolation and identification of the cross-linked protein complexes. This approach can provide spatial information about the interaction interface between lspA and any host proteins.

RNA interference (RNAi) or CRISPR-based approaches targeting specific ant host genes can provide functional evidence for interactions. By systematically knocking down host genes and observing effects on Blochmannia survival, membrane integrity, or lspA localization, researchers can identify host factors that interact functionally, if not physically, with the bacterial lipoprotein processing machinery . This reverse genetic approach is particularly valuable for identifying host components that might be essential for proper functioning of bacterial membrane proteins like lspA.

How can researchers design effective inhibitors for Blochmannia pennsylvanicus lspA for functional studies?

Designing effective inhibitors for Blochmannia pennsylvanicus Lipoprotein signal peptidase represents a challenging but valuable approach for functional studies of this enzyme. Several methodological strategies can guide the development of specific inhibitors that can serve as powerful tools for understanding lspA's role in bacterial physiology and host-symbiont interactions.

Structure-based design approaches offer a rational pathway to inhibitor development. While the crystal structure of B. pennsylvanicus lspA has not been reported, homology modeling based on related signal peptidases with known structures can provide a reasonable approximation of the enzyme's active site architecture . Computational docking studies can then be used to screen virtual libraries of compounds for those predicted to bind effectively to the catalytic site. The unique catalytic dyad of aspartate residues in lspA presents a specific target for inhibitor design, distinct from the serine proteases that are more commonly targeted by protease inhibitors.

Peptidomimetic approaches represent another promising strategy. Based on the known substrate preferences of lspA, researchers can design peptide-based inhibitors that mimic the lipobox recognition sequence but incorporate modifications that prevent cleavage, such as non-hydrolyzable isosteres at the scissile bond. These peptidomimetics can be further optimized by incorporating reactive groups that form covalent bonds with the active site residues, creating irreversible inhibitors with high specificity .

High-throughput screening of compound libraries can identify novel inhibitor scaffolds. Assays using fluorogenic peptide substrates can be adapted to microplate formats, allowing rapid testing of thousands of compounds for inhibitory activity against purified recombinant lspA. Hits from such screens provide starting points for medicinal chemistry optimization to improve potency, specificity, and physicochemical properties.

The table below outlines potential inhibitor design strategies for B. pennsylvanicus lspA:

ApproachMethodologyAdvantagesChallenges
Structure-based designHomology modeling, virtual screeningRational targeting of active siteAccuracy limited by model quality
PeptidomimeticsBased on natural substrate sequencesHigh specificity for lspAPotentially poor membrane permeability
Covalent inhibitorsIncorporation of reactive warheadsIrreversible inhibition, high potencyPotential off-target reactivity
Natural product derivativesModification of known SPase II inhibitorsEstablished bioactivitySynthetic complexity
Fragment-based discoveryScreening of low MW fragmentsNovel chemical space explorationRequires structural data for optimization

Validation of inhibitor specificity is crucial for functional studies. Lead compounds should be tested against other proteases, particularly those with similar catalytic mechanisms, to ensure selectivity for lspA. Additionally, the effects of inhibitors on bacterial growth, membrane integrity, and host-symbiont interactions should be characterized to establish their utility as tools for studying lspA function in biological contexts .

In designing inhibitors, researchers should also consider membrane permeability, as lspA is a membrane-embedded enzyme. Compounds with appropriate lipophilicity may be required to reach the active site effectively within the bacterial membrane environment. For studies in intact bacteria or host-symbiont systems, inhibitors may need to be optimized for penetration of both the bacterial and host cell membranes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.