Recombinant Blochmannia pennsylvanicus Magnesium transport protein CorA (corA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Blochmannia pennsylvanicus Magnesium Transport Protein CorA (corA)

The CorA family of proteins is crucial for magnesium homeostasis in bacteria, archaea, and eukaryotic mitochondria. While specific information on the recombinant Blochmannia pennsylvanicus magnesium transport protein CorA (corA) is limited, understanding its function can be inferred from studies on similar CorA proteins in other organisms. Blochmannia pennsylvanicus is a bacterium that lives symbiotically within certain insects, and its magnesium transport mechanisms would be essential for maintaining cellular homeostasis.

Structure and Function of CorA Proteins

CorA proteins generally form pentamers, with each subunit contributing to a central pore that facilitates magnesium transport across cell membranes . The structure includes a transmembrane domain (TMD) connected to an intracellular domain (ICD) by a stalk helix. The periplasmic entrance contains a conserved GMN motif, which acts as a selectivity filter for magnesium ions .

Key Features of CorA Proteins:

  • Pentameric Structure: Essential for forming a functional channel.

  • GMN Motif: Acts as a selectivity filter for magnesium ions.

  • Intracellular Domain (ICD): Contains binding sites for magnesium ions, crucial for regulating channel activity.

Mechanism of Magnesium Transport

The transport mechanism involves the release of magnesium ions from the intracellular domain when intracellular magnesium levels are low. This release triggers conformational changes that open the channel, allowing magnesium ions to flow into the cell . The process is regulated by the presence of magnesium ions at specific binding sites within the protein.

Transport Kinetics:

IonKm (μM)Vmax (pmol/min/10^8 cells)Ki (μM)
Mg²⁺15250-
Co²⁺3050050
Ni²⁺240360300

Table 1: Transport kinetics of CorA for different ions .

Role in Cellular Homeostasis and Pathogenicity

Magnesium transporters like CorA are vital for maintaining cellular magnesium levels, which are essential for numerous enzymatic reactions and cellular processes. In pathogens, such as Pectobacterium versatile, CorA plays a role in virulence by influencing exoenzyme production and intracellular survival .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
corA; BPEN_597; Magnesium transport protein CorA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Blochmannia pennsylvanicus (strain BPEN)
Target Names
corA
Target Protein Sequence
MYNIFQLKNNHLFRINEKDKISFLNNIIWIDIIDSCGDGHNYIPNILLHQKIKFFELKDI NKTTRFFKDKNGLHIHSFFFSYNSQEQIDNSSVFFTIHNGCLYTSRKKEFPVFCMYQKYL HNHLLINGNAYELLLNLFEVKLDDLTNKIEHIYATLETLSSVIMNGQQIDEYDHALSDLA ILENIGWKIRVNLLDTERAIKFLIRKVKLPVSQQKYANDILNEITLLLPHNEYVFHQISS LTQSAMGFINIEQNRIIKIFSVIFLPPTLIASSYGMNFKFMPELQWSFGYPSAIILMILS GLAPYIYFKYKNWL
Uniprot No.

Target Background

Function

This protein mediates the influx of magnesium ions and can also facilitate cobalt and manganese uptake. It functions through alternating open and closed states, activated by low cytoplasmic Mg2+ levels and inactivated when cytoplasmic Mg2+ levels are high.

Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the corA gene in Blochmannia pennsylvanicus?

The corA gene is located within the 792-kb genome of Blochmannia pennsylvanicus, which has undergone significant reduction compared to free-living bacteria. Despite this genome reduction, B. pennsylvanicus and B. floridanus show complete conservation in the order and strand orientation of shared genes, suggesting extraordinary genomic stability characteristic of long-term bacterial mutualists of insects . The genomic context of corA likely reflects this conservation pattern, though specific gene neighborhood analysis would require targeted investigation of the B. pennsylvanicus genome sequence. Methodologically, researchers should use comparative genomics approaches to evaluate synteny with related species, particularly examining if corA exists in a conserved gene cluster that might indicate functional relationships.

How does the CorA protein from B. pennsylvanicus compare structurally to CorA proteins from other bacterial species?

Structural analysis indicates that B. pennsylvanicus CorA likely maintains the canonical pentameric architecture with transmembrane domains for magnesium ion conduction, though with adaptation to the endosymbiotic lifestyle. A comparative structural approach involves:

  • Sequence alignment with well-characterized CorA proteins

  • Homology modeling based on crystallized CorA structures

  • Prediction of transmembrane domains and functional motifs

  • Molecular dynamics simulations to assess ion conductance patterns

Researchers should note that while amino acid substitution rates in Blochmannia are 10-50 fold faster than related bacteria , functionally important domains typically maintain higher conservation. Analysis of nonsynonymous to synonymous substitution ratios (dN/dS) across the protein sequence can help identify regions under different selective pressures.

What expression systems are most effective for recombinant production of B. pennsylvanicus CorA protein?

When designing expression systems for recombinant B. pennsylvanicus CorA, researchers should consider the following methodological approach:

  • Vector selection: pET expression systems with T7 promoters provide high-level expression, but toxic membrane proteins may benefit from tightly regulated arabinose-inducible systems

  • Host strains: Consider magnesium-transport deficient E. coli strains (MM281, MM284) to:

    • Provide functional complementation assays

    • Reduce toxicity during overexpression

    • Eliminate competition from host CorA proteins

  • Fusion tags: N-terminal His6 tags generally interfere less with membrane insertion than C-terminal tags

  • Induction conditions: Lower temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.5 mM) favor proper membrane protein folding

Table 1. Comparison of Expression Systems for Recombinant CorA Production

Expression SystemAdvantagesDisadvantagesOptimal Conditions
pET-based/T7High expressionPotential toxicity18°C, 0.2mM IPTG, 16h
pBAD/ArabinoseTight regulationLower yield25°C, 0.02% arabinose, 4h
pMAL-p5XIncreased solubilityLarger fusion protein25°C, 0.3mM IPTG, 4h
Cell-free systemsAvoids toxicityHigher cost30°C, 4h, supplemented with lipids

What purification strategies yield highest purity and functionality for recombinant B. pennsylvanicus CorA?

Purification of functional recombinant B. pennsylvanicus CorA requires careful handling of membrane proteins. A methodological workflow includes:

  • Membrane isolation: Differential centrifugation following cell lysis, with multiple washing steps to remove peripheral proteins

  • Detergent screening: Systematic testing of detergents (DDM, LDAO, MNG) at various concentrations to identify optimal solubilization conditions

  • Purification steps:

    • IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA with imidazole gradient elution

    • Size exclusion chromatography to separate pentameric CorA from aggregates and monomers

    • Ion exchange chromatography for final polishing

  • Stability assessment: Thermal shift assays to identify stabilizing buffer conditions

When evaluating purification quality, researchers should assess both protein purity (SDS-PAGE, Western blot) and functionality (magnesium uptake assays). Maintain physiologically relevant magnesium concentrations during purification to preserve the native conformation of CorA, as the protein undergoes conformational changes based on magnesium availability.

What experimental approaches can determine the magnesium transport kinetics of recombinant B. pennsylvanicus CorA protein?

For rigorous characterization of magnesium transport kinetics, implement multi-faceted approaches:

  • Radioisotope uptake assays: Use 28Mg2+ to measure direct transport in:

    • Proteoliposomes reconstituted with purified CorA

    • Whole cells expressing recombinant CorA

    • Inverted membrane vesicles

  • Fluorescence-based assays:

    • Mag-fura-2 for real-time monitoring of intracellular Mg2+ concentrations

    • Membrane potential sensitive dyes to correlate transport with ΔΨ changes

  • Electrophysiological measurements:

    • Patch-clamp analysis of giant liposomes

    • Planar lipid bilayer recordings

Data analysis should include:

  • Determination of Km and Vmax values

  • Evaluation of transport inhibitors (cobalt hexamine, ruthenium red)

  • Assessment of selectivity against other divalent cations

Given that B. pennsylvanicus exists in an endosymbiotic relationship, researchers should consider how host factors might modulate transport activity, particularly examining whether ant cell-derived compounds affect CorA function.

How can researchers assess the role of specific amino acid residues in B. pennsylvanicus CorA function?

A systematic structure-function analysis requires:

  • Site-directed mutagenesis:

    • Target the conserved GMN motif essential for magnesium selectivity

    • Examine transmembrane domains for residues lining the conduction pathway

    • Investigate cytoplasmic domains potentially involved in gating mechanisms

  • Functional assessment of mutants:

    • Complementation assays in CorA-deficient E. coli strains

    • Mg2+ uptake assays comparing wild-type and mutant proteins

    • Thermal stability comparisons to assess structural integrity

  • Structural confirmation:

    • Circular dichroism to confirm secondary structure preservation

    • Limited proteolysis to evaluate conformational changes

    • FRET-based approaches to monitor distance changes during gating

When interpreting results, consider the non-synonymous divergence patterns between Blochmannia species, which suggest selection pressure to maintain protein function despite amino acid substitutions . The ratio of nonsynonymous to synonymous substitutions (dN/dS well below 0.13) observed in other Blochmannia genes suggests functional conservation despite sequence divergence.

How does the evolutionary adaptation of CorA in B. pennsylvanicus reflect its endosymbiotic lifestyle?

Examining the evolutionary trajectory of CorA in B. pennsylvanicus requires comparative analysis framed within the context of genome reduction and host adaptation:

  • Phylogenetic analysis:

    • Construct maximum likelihood trees of CorA sequences across bacterial lineages

    • Calculate selection pressures (dN/dS) specifically for CorA relative to genome-wide averages

    • Identify accelerated evolution in specific domains

  • Functional comparison:

    • Compare transport kinetics of B. pennsylvanicus CorA with free-living bacterial orthologs

    • Assess substrate specificity changes that might reflect host environment

  • Structural adaptation analysis:

    • Evaluate sequence conservation in known functional motifs

    • Identify unique insertions/deletions that might reflect adaptation

The extreme genomic stability observed in Blochmannia species, particularly the complete conservation in gene order and orientation , suggests strong selective pressure to maintain genomic architecture. This stability likely extends to essential genes like corA, though amino acid substitution rates may still be 10-50 fold faster than in free-living bacteria.

What is the relationship between host ant physiology and B. pennsylvanicus CorA function?

Investigating the host-symbiont relationship requires methodological approaches that span both bacterial and host systems:

  • Temporal expression analysis:

    • Quantify corA expression across different developmental stages of the host ant

    • Correlate expression with host magnesium requirements and availability

  • Localization studies:

    • Use immunofluorescence to track CorA distribution within bacteriocytes

    • Examine co-localization with host magnesium transporters

  • Metabolic integration assessment:

    • Trace magnesium flux between host and symbiont using isotope labeling

    • Determine how magnesium availability affects endosymbiont metabolic output

The obligate endosymbiotic lifestyle of B. pennsylvanicus means its magnesium transport must be integrated with host physiology. Like other bacterial endosymbionts, Blochmannia has maintained genes essential for its contribution to the symbiotic relationship while losing others through reductive evolution, a pattern that provides context for understanding the retention and function of corA in this system.

What are common pitfalls in recombinant expression of B. pennsylvanicus CorA and how can they be addressed?

Researchers frequently encounter several technical challenges when working with recombinant membrane proteins like CorA:

  • Inclusion body formation:

    • Solution: Lower expression temperature (16°C), reduce inducer concentration

    • Alternative: Develop refolding protocols from inclusion bodies using chaotropes and carefully controlled detergent dialysis

  • Protein instability:

    • Solution: Screen buffer conditions systematically (pH, salt, additives)

    • Implement high-throughput thermal shift assays to identify stabilizing conditions

  • Poor yield:

    • Solution: Optimize codon usage for expression host

    • Consider fusion partners that enhance expression (MBP, SUMO)

  • Functional assessment difficulties:

    • Solution: Develop robust control experiments using known CorA inhibitors

    • Implement multiple complementary functional assays

Table 2. Troubleshooting Guide for Common Technical Challenges

ChallengeIndicatorsSolutionsValidation Methods
Inclusion bodiesInsoluble protein pelletLower temperature, weaker promoterSolubility assays
Protein misfoldingMultiple bands on native PAGEDetergent screening, additivesCD spectroscopy
Loss of functionNo Mg2+ transportMaintain Mg2+ during purificationComplementation assays
AggregationElution in void volume on SECAdd stabilizing lipidsDLS analysis
Proteolytic degradationMultiple bands on SDS-PAGEAdd protease inhibitorsMass spectrometry

How can researchers distinguish between functional and structural effects when analyzing CorA mutations?

When conducting mutagenesis studies, separating direct functional impacts from structural perturbations requires methodical approaches:

  • Structural integrity assessment:

    • Circular dichroism to confirm secondary structure maintenance

    • Size exclusion chromatography to verify pentameric assembly

    • Thermal shift assays to quantify stability changes

  • Functional mapping:

    • Transport assays normalized to protein expression levels

    • Dose-response curves with transport inhibitors

    • Mg2+ binding assays using isothermal titration calorimetry

  • Computational validation:

    • Molecular dynamics simulations to assess conformation changes

    • Energy minimization calculations to predict structural destabilization

Interpretation should consider the evolutionary context of Blochmannia, where protein divergences between B. pennsylvanicus and B. floridanus suggest functional constraints despite sequence changes .

What emerging technologies could enhance research on B. pennsylvanicus CorA?

Cutting-edge methodologies that could advance understanding of B. pennsylvanicus CorA include:

  • Cryo-EM analysis:

    • High-resolution structural determination in different conformational states

    • Visualization of CorA within native membrane environments

  • Single-molecule FRET:

    • Real-time monitoring of conformational changes during transport

    • Correlation of structural dynamics with function

  • Advanced genome editing:

    • Development of genetic manipulation systems for Blochmannia

    • CRISPR-based approaches for endosymbiont modification

  • Systems biology integration:

    • Multi-omics approaches linking CorA function to global metabolic networks

    • Mathematical modeling of magnesium homeostasis in the host-symbiont system

These approaches would help address the broader significance of CorA in the context of host-symbiont interactions, potentially revealing how this ancient transport system has adapted to the specialized endosymbiotic lifestyle.

How can insights from B. pennsylvanicus CorA research be applied to understanding other bacterial endosymbionts?

Comparative approaches that extend findings from B. pennsylvanicus to other systems include:

  • Cross-species functional analysis:

    • Heterologous expression of CorA proteins from diverse endosymbionts

    • Systematic comparison of transport kinetics and regulation

  • Evolutionary model development:

    • Reconstruction of ancestral CorA sequences

    • Correlation of functional changes with divergence times

  • Host-range extension studies:

    • Investigation of CorA adaptation across different insect-bacteria symbioses

    • Analysis of convergent evolution in magnesium transport systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.