Recombinant Blochmannia pennsylvanicus NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. Please indicate your desired tag type for preferential development.
Synonyms
nuoA; BPEN_509; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Blochmannia pennsylvanicus (strain BPEN)
Target Names
nuoA
Target Protein Sequence
MCDIYHWGLIAFIVGILFLCVFMLSCGYFLGGCSSSRSKNVPFESGIKSIGNARIQFSVK FYLIAMFFVIFDVEGIYVYAWAISVRDVGWIGFSEIFIFIFILLVSLIYLIRIGMFDWIE QSSRHVHCVDFFDIDTSRYLKKSNKR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Blochmannia pennsylvanicus and what makes it significant for research?

Blochmannia pennsylvanicus is an obligate bacterial endosymbiont found in Camponotus pennsylvanicus carpenter ants. These bacteria belong to Gammaproteobacteria and reside within specialized host cells called bacteriocytes. Their significance stems from their essential mutualistic relationship with ant hosts, where they provide nutritional functions including synthesis of essential amino acids necessary for host development . The B. pennsylvanicus genome is 792 kb in size, making it valuable for studying genome reduction and evolution in obligate symbionts . This bacterial system presents an excellent model for investigating host-symbiont co-evolution, metabolic integration, and specialized protein functions in the context of obligate intracellular lifestyles.

What is NADH-quinone oxidoreductase and what role does subunit A play?

NADH-quinone oxidoreductase (Complex I) is a multi-subunit enzyme complex that forms the first component of the electron transport chain in bacterial respiratory systems. It catalyzes electron transfer from NADH to quinones, coupled with proton translocation across the membrane, contributing to the proton motive force used for ATP synthesis. The nuoA subunit is a membrane-embedded component that, while small (typically around 119 amino acids as seen in related bacteria), plays a crucial structural role in the membrane arm of the complex . In endosymbionts like Blochmannia with reduced genomes, the maintenance of this gene suggests its essential function in energy metabolism despite the streamlined genome, potentially contributing to the symbiont's ability to support host nutrition.

Why study recombinant proteins from bacterial endosymbionts?

Studying recombinant proteins from bacterial endosymbionts provides several research advantages. First, since obligate endosymbionts like Blochmannia cannot be cultivated in isolation, recombinant protein expression in systems like E. coli represents the only practical way to obtain sufficient quantities of these proteins for biochemical and structural studies . Second, these proteins often exhibit unique adaptations resulting from co-evolution with their hosts, as evidenced by the 10-50 fold faster amino acid substitution rates observed in Blochmannia compared to related free-living bacteria . These accelerated rates suggest potential functional adaptations that may reveal novel biochemical properties. Finally, studying specific components like nuoA helps elucidate how essential cellular processes are maintained in reduced genomes, providing insights into the minimal requirements for cellular function.

How should researchers approach cloning and expression of B. pennsylvanicus nuoA?

When designing experiments for cloning and expressing B. pennsylvanicus nuoA, researchers should consider several factors specific to this endosymbiont. First, codon optimization is essential due to the low GC content (29.0%) typical of Blochmannia genomes . This significant deviation from E. coli's GC content necessitates codon optimization to ensure efficient translation. Second, expression vector selection should account for the membrane-embedded nature of nuoA; vectors containing appropriate signal sequences or fusion partners that facilitate membrane integration are preferable. For example, vectors incorporating His-tags (as used for related proteins) can facilitate purification while minimizing interference with protein folding .

The expression protocol should include induction at lower temperatures (16-20°C) to slow protein production and allow proper folding of this membrane protein. Additionally, the use of E. coli strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3), is recommended. Verification of successful expression should employ both SDS-PAGE and Western blotting techniques, with protein identity confirmation via mass spectrometry.

What purification strategies are most effective for recombinant B. pennsylvanicus nuoA?

Purification of recombinant B. pennsylvanicus nuoA requires specialized approaches due to its hydrophobic, membrane-embedded nature. A multi-step purification strategy is recommended, beginning with cell lysis using detergent-based methods to solubilize membrane proteins. Detergent selection is critical; mild detergents like n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) often provide the best balance between effective solubilization and maintaining protein structure.

For His-tagged constructs, immobilized metal affinity chromatography (IMAC) serves as an effective initial purification step . This should be followed by size exclusion chromatography to remove aggregates and achieve higher purity. Throughout purification, maintaining the protein in detergent micelles or reconstituting it into nanodiscs or liposomes helps preserve native conformation. Purity assessment should aim for >90% as verified by SDS-PAGE , with functionality potentially assessed through NADH oxidation activity assays when the protein is reconstituted with other complex I components.

How can researchers verify the structural integrity and functionality of purified recombinant nuoA?

Verifying the structural integrity and functionality of purified recombinant nuoA presents unique challenges due to its role as part of a larger complex. Circular dichroism (CD) spectroscopy provides initial insights into secondary structure content and proper folding. More detailed structural assessment may require reconstitution experiments with other Complex I components, as nuoA's functionality depends on its interactions within the larger complex.

For functional verification, researchers should consider reconstitution experiments combining recombinant nuoA with other subunits of Complex I or with membrane fractions containing partial complexes. NADH oxidation assays can then assess electron transport functionality, though these may require the presence of multiple subunits. Alternative approaches include binding assays with known interaction partners from the complex and thermal stability assays to compare the recombinant protein with native forms where available.

Cryo-electron microscopy may offer structural insights when nuoA is successfully incorporated into larger assemblies. Additionally, complementation studies in bacterial systems with defective native nuoA could provide functional validation in a cellular context.

How does the sequence and structure of B. pennsylvanicus nuoA reflect its evolutionary adaptation to the endosymbiotic lifestyle?

The sequence and structure of B. pennsylvanicus nuoA likely reflect significant evolutionary adaptations driven by the endosymbiotic lifestyle. Genomic analyses reveal that Blochmannia species demonstrate 10-50 fold faster amino acid substitution rates compared to related free-living bacteria . This accelerated evolutionary rate suggests relaxed selection pressure on certain protein functions while maintaining essential roles. For nuoA specifically, researchers should examine amino acid substitutions at positions typically conserved in free-living bacteria to identify potential endosymbiont-specific adaptations.

Despite this rapid sequence evolution, Blochmannia genomes display remarkable architectural stability, with complete conservation in gene order and orientation between species . This paradoxical combination of sequence plasticity with structural rigidity suggests complex evolutionary constraints. The maintenance of nuoA in the Blochmannia genome, despite extensive gene loss (only 631 protein-coding genes remain in related Blochmannia species ), indicates its essential function in the symbiotic relationship, potentially linked to energy production necessary for amino acid synthesis pathways that benefit the host.

Comparative analyses across multiple Blochmannia species could reveal selection patterns specifically affecting electron transport chain components, providing insights into metabolic adaptations in nutrient-exchanging endosymbionts.

What insights can B. pennsylvanicus nuoA provide regarding the minimal functional requirements of respiratory chains in endosymbionts?

Studying B. pennsylvanicus nuoA offers valuable insights into the minimal functional requirements of respiratory chains in obligate endosymbionts. The retention of Complex I components in the highly reduced genome of Blochmannia (792 kb) suggests that maintaining energy production through aerobic respiration remains essential despite genome reduction. This contrasts with some other endosymbionts that have lost portions of their respiratory chains, indicating different metabolic strategies among bacterial symbionts.

The specific conservation patterns within nuoA's sequence can reveal which structural elements are absolutely essential for function versus those that permit variation. Particularly informative are comparisons with nuoA sequences from other Blochmannia species, such as those from C. floridanus or C. nipponensis , which may reveal lineage-specific adaptations potentially correlating with different host ant metabolic requirements.

Furthermore, the study of nuoA in the context of Blochmannia's nitrogen metabolism is particularly relevant. Blochmannia performs key roles in nitrogen recycling for their hosts, with some species like B. vafer showing loss of glutamine synthetase while retaining urease . Understanding how energy-generating systems like Complex I support these variable nitrogen metabolism pathways may reveal how metabolic networks evolve under selective pressure in symbiotic relationships.

How might the co-evolution between Blochmannia and its ant hosts have influenced the functional properties of nuoA?

The co-evolutionary relationship between Blochmannia and Camponotus ants has likely shaped nuoA's functional properties in response to host metabolic needs. This bacterial-ant association has resulted in differential gene loss patterns across Blochmannia species that reflect host ecological niches . The maintenance of respiratory chain components like nuoA suggests they support essential symbiotic functions, particularly the synthesis of essential amino acids that the host cannot produce independently .

The impact of this co-evolution on nuoA may manifest in several ways. First, adaptation to the relatively stable environment within bacteriocytes might lead to optimizations for the specific pH, temperature, and metabolite concentrations found in these specialized cells. Second, the protein may have evolved to function efficiently with the limited metabolic resources available in the endosymbiotic environment. Third, potential regulatory adaptations might allow coordination of respiratory activity with host physiological states, particularly during developmental stages when endosymbiont contributions are most critical .

Experimental approaches to investigate these co-evolutionary adaptations could include comparing the kinetic properties of recombinant nuoA from different Blochmannia species, correlating functional differences with host ant ecology and behavior. Additionally, examining nuoA expression patterns during different host developmental stages could reveal temporal aspects of this co-evolutionary relationship.

What are the main challenges in expressing and studying membrane proteins from obligate endosymbionts?

Expressing and studying membrane proteins from obligate endosymbionts like Blochmannia presents several significant challenges. First, the inability to culture these organisms independently means researchers must rely entirely on genomic data for gene sequences, without the possibility of directly isolating native proteins for comparison . Second, the atypical codon usage and low GC content (approximately 29%) characteristic of Blochmannia can cause translation inefficiencies in common expression hosts like E. coli.

The membrane-embedded nature of nuoA adds further complications, as expression may lead to toxicity, inclusion body formation, or improper folding in heterologous systems. Additionally, the proper functioning of nuoA depends on interactions with other Complex I components, making functional studies of the isolated subunit challenging. The rapid evolutionary rate observed in Blochmannia proteins (10-50 fold faster than related bacteria) may also result in unusual structural features that complicate expression and folding in heterologous systems.

To overcome these challenges, researchers should consider approaches such as: (1) synthetic gene synthesis with codon optimization, (2) testing multiple expression systems beyond E. coli, including cell-free systems, (3) employing fusion partners that enhance membrane protein solubility, and (4) developing reconstitution systems with other Complex I components to enable functional studies.

How can researchers differentiate between functional adaptations and genetic drift in B. pennsylvanicus nuoA sequence variations?

Differentiating between functional adaptations and genetic drift in B. pennsylvanicus nuoA sequence variations requires a comprehensive analytical approach combining evolutionary, structural, and functional analyses. First, researchers should perform detailed comparative sequence analyses across multiple Blochmannia species and related free-living bacteria to identify conservation patterns. Sites under positive selection (Ka/Ks > 1) may indicate adaptive evolution, while purifying selection (Ka/Ks < 1) suggests functional constraint.

Structural mapping of variable versus conserved residues onto protein models can reveal whether variations occur at functionally significant sites or surface-exposed regions less critical for function. Particularly informative is the analysis of variations at known functional sites, such as quinone-binding regions or subunit interaction interfaces, which would likely reflect adaptive rather than neutral changes.

Experimental validation is essential and can include site-directed mutagenesis to revert potentially adaptive mutations and assess functional consequences. Creating chimeric proteins with domains from different Blochmannia species or free-living relatives can identify regions responsible for functional differences. Additionally, comparing expression levels, stability, and activity of recombinant nuoA variants under different conditions mimicking the host environment may reveal condition-specific adaptations.

This multi-faceted approach helps distinguish between sequence changes that represent neutral drift and those that contribute to the symbiont's adaptation to its specialized ecological niche.

What bioinformatic approaches are most effective for analyzing potential functional differences between B. pennsylvanicus nuoA and its homologs in free-living bacteria?

Effective bioinformatic analysis of B. pennsylvanicus nuoA requires specialized approaches that account for the unique evolutionary context of endosymbionts. Sequence-based analyses should begin with comprehensive homology searches using position-specific scoring matrices rather than simple BLAST searches to detect distant relationships despite rapid sequence evolution. Multiple sequence alignments should incorporate structural information when available, using structure-guided alignment tools that can identify conserved functional motifs despite sequence divergence.

Evolutionary rate analysis is particularly valuable, as Blochmannia proteins evolve 10-50 times faster than their free-living counterparts . Site-specific evolutionary rate calculations can identify regions evolving under different selective pressures. Correlation analyses between evolutionary rates and known functional regions can highlight endosymbiont-specific adaptations versus generally conserved features.

Structural prediction and modeling approaches become essential when experimental structures are unavailable. For membrane proteins like nuoA, specialized prediction tools that incorporate lipid interaction surfaces and transmembrane topology should be employed. Molecular dynamics simulations comparing models of B. pennsylvanicus nuoA with free-living bacterial homologs can predict functional differences in stability, flexibility, and interaction potential.

Network analysis examining co-evolving residues within nuoA or between nuoA and other Complex I subunits can reveal functional dependencies that may differ between endosymbionts and free-living bacteria, reflecting adaptation to the symbiotic lifestyle.

How might understanding B. pennsylvanicus nuoA contribute to broader knowledge of symbiotic systems?

Understanding B. pennsylvanicus nuoA contributes significantly to our knowledge of symbiotic systems by providing insights into the bioenergetic foundations of nutritional mutualisms. The retention of respiratory chain components like nuoA in the highly reduced Blochmannia genome (792 kb) indicates that energy production remains essential despite extensive genomic streamlining. This reveals fundamental constraints in evolving obligate symbiotic relationships, suggesting that certain metabolic functions cannot be delegated to the host regardless of intimacy level.

The study of nuoA in Blochmannia can illuminate how energy metabolism is integrated with symbiont-specific functions such as amino acid biosynthesis. Blochmannia genomes contain pathways for essential amino acids (except arginine) needed for host development , and understanding how these pathways are energetically supported reveals the metabolic interdependencies in the symbiosis. Experiments demonstrating that antibiotic reduction of Blochmannia significantly impacts ant brood development highlight the crucial role these bacteria play in host fitness.

Comparative studies of nuoA across different Blochmannia species can also reveal how host ecology drives symbiont adaptation. The observed lineage-specific patterns of gene loss and sequence evolution in Blochmannia suggest that different host ant species may exert varying selective pressures on their symbionts' energy metabolism, potentially reflecting ecological adaptations.

What experimental approaches could be used to investigate the role of nuoA in the context of the Blochmannia-ant symbiosis?

Investigating nuoA's role in the Blochmannia-ant symbiosis requires creative experimental approaches that overcome the challenges of working with uncultivable endosymbionts. One powerful approach involves manipulating Blochmannia populations in ant colonies using targeted antibiotics, then measuring metabolic consequences and supplementing with recombinant nuoA or related components. Previous studies have shown that antibiotic treatment reduces endosymbiont levels by 67% in workers and 99.98% in eggs, with significant impacts on brood development .

Molecular approaches could include developing systems for heterologous expression of Blochmannia respiratory complexes in model bacteria, potentially complementing respiratory-deficient strains. Creating recombinant strains expressing fluorescently tagged nuoA could enable visualization of protein localization within bacteriocytes when reintroduced to the ant system, potentially revealing spatial organization of respiratory functions within these specialized cells.

Metabolomic approaches comparing antibiotic-treated and untreated ants can identify specific metabolic pathways dependent on functional Blochmannia respiratory chains. Stable isotope labeling experiments could trace the flow of nutrients between host and symbiont, revealing how energy generated through nuoA-containing complexes supports nutrient exchange.

In vitro reconstitution experiments combining recombinant nuoA with other respiratory complex components in artificial membrane systems could assess functionality under varying conditions mimicking the bacteriocyte environment, providing insights into adaptation to the endosymbiotic lifestyle.

How might research on B. pennsylvanicus nuoA inform our understanding of mitochondrial evolution and other endosymbiotic relationships?

Research on B. pennsylvanicus nuoA offers valuable parallels to mitochondrial evolution, as both represent cases where respiratory chain components function within host cells. The Blochmannia-ant system represents an ongoing symbiosis estimated to be 30-40 million years old , which is much younger than the mitochondrial endosymbiosis. This provides an opportunity to observe intermediate stages of integration that might illuminate aspects of early mitochondrial evolution.

Comparative analysis of nuoA between Blochmannia, free-living bacteria, and mitochondria can reveal convergent adaptations to the intracellular environment. The observed genome stability in Blochmannia, with complete conservation of gene order despite rapid sequence evolution , mirrors patterns seen in mitochondrial genomes, suggesting similar evolutionary constraints in endosymbiotic systems.

The study of how Blochmannia nuoA functions in nitrogen metabolism and recycling pathways can inform our understanding of metabolic integration in symbioses. Some Blochmannia species show differential loss of nitrogen metabolism components, with B. vafer notably losing glutamine synthetase while retaining urease . These varying patterns of pathway retention reflect differing levels of metabolic complementation between host and symbiont, a process fundamental to mitochondrial evolution.

Furthermore, understanding protein-protein interactions between nuoA and other respiratory components in the context of rapid sequence evolution can provide insights into how multi-subunit complexes maintain functionality despite evolutionary change, a challenge faced during mitochondrial integration into eukaryotic cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.