Recombinant Blue-light absorbing proteorhodopsin

Shipped with Ice Packs
In Stock

Description

Spectroscopic Properties

BPR exhibits the most blue-shifted absorption maximum (520–540 nm) among bacterial retinal proteins, except sensory rhodopsin II .

  • pH dependence: The absorption spectrum red-shifts by 0.22 eV at low pH due to protonation of Glu-143, altering the electrostatic environment of the retinal .

  • Spectral tuning: Molecular orbital calculations attribute wavelength regulation to interactions between the protonated Schiff base and residues in the counterion complex .

Table 2: Spectroscopic Data

ConditionAbsorption Maximum (nm)NotesSource
High pH520–525Similar to sensory rhodopsin II
Low pH540–545Resembles bacteriorhodopsin

Proton-Pumping Mechanism

  • Photocycle: Light absorption triggers retinal isomerization, initiating proton transfer from the Schiff base to Asp-97. A conserved His75 interacts with Trp34 in adjacent protomers, suggesting cooperative behavior in oligomers .

  • Divergence from bacteriorhodopsin: BPR lacks Wat402, a critical water molecule in bacteriorhodopsin’s proton relay, implying a distinct ion-transfer pathway .

Debate on Physiological Role

While BPR is widely considered a proton pump, its structural homology with sensory rhodopsin II raises questions about potential light-sensing functions .

Biotechnological Applications

Recombinant BPR is engineered for stability and scalability:

  • Expression systems: Optimized in Escherichia coli with yields enabling crystallization .

  • Energy harvesting: Incorporated into synthetic membranes for light-driven ATP synthesis .

Table 3: Performance in Proton-Pumping Assays

SystemΔpH AchievedLight SourceSource
BPR proteoliposomes−1.2Green light (534 nm)
E. coli cell membranes−0.8Blue light (520 nm)

Research Advancements

  • Cryo-EM insights: Pentameric assemblies show enhanced stability in detergents like Cymal-5, aiding structural studies .

  • Mutagenesis: The D97N mutant (Asp→Asn) facilitates crystallization without disrupting proton transport .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will accommodate your request.
Lead Time
The delivery timeframe may vary depending on the purchasing method and location. For precise delivery estimates, please contact your local distributors.
As a standard practice, all our proteins are shipped with regular blue ice packs. If you require dry ice shipping, kindly communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. To enable multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Blue-light absorbing proteorhodopsin; BPR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-251
Protein Length
Full Length of Mature Protein
Species
Gamma-proteobacterium Hot 75m4
Target Protein Sequence
AAGGDLDISDTVGVSFWLVTAGMLAATVFFFVERDQVSAKWKTSLTVSGLITGIAFWHYL YMRGVWIDTGDTPTVFRYIDWLLTVPLQVVEFYLILAACTSVAASLFKKLLAGSLVMLGA GFAGEAGLAPVLPAFIIGMAGWLYMIYELYMGEGKAAVSTASPAVNSAYNAMMMIIVVGW AIYPAGYAAGYLMGGEGVYASNLNLIYNLADFVNKILFGLIIWNVAVKESSNA
Uniprot No.

Target Background

Function
This protein functions as a light-driven proton pump. Based on light-induced opening of proton channels, its role might be regulatory rather than energy harvesting, potentially modulating cell physiology in response to variations in light intensity. Therefore, it could be classified as a sensory rhodopsin, possibly associated with a transducer component.
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is blue-light absorbing proteorhodopsin and how does it differ from other proteorhodopsins?

Blue-light absorbing proteorhodopsin (BPR) is a seven-transmembrane chromoprotein that contains retinal as a chromophore and functions as a light-driven proton pump. BPR is distinguished by having the most blue-shifted absorption maximum of all retinal proteins found in archaea or bacteria, with the exception of sensory rhodopsin II (SRII) . Unlike green-light absorbing proteorhodopsins, BPR is optimized to capture blue light that penetrates deeper ocean waters. BPR also exhibits a remarkably large pH dependence in its absorption spectrum, greater than that observed in any other retinal protein . At high pH, BPR has spectroscopic properties similar to SRII, but at low pH, its spectroscopic properties more closely resemble bacteriorhodopsin (BR) .

What is the primary function of blue-light absorbing proteorhodopsin in bacterial cells?

Blue-light absorbing proteorhodopsin primarily functions as a light-driven proton pump that transports protons across cellular membranes to create stored electrochemical energy . This function becomes particularly critical when a bacterial cell's ability to respire oxygen is impaired . By harvesting light energy, proteorhodopsin enables bacterial cells to supplement respiration as a cellular energy source, providing a significant advantage in oxygen-depleted marine environments . This adaptation explains why proteorhodopsin is widely expressed in ocean bacteria, especially in "dead zones" that lack sufficient oxygen to sustain normal respiratory processes .

How can I express and purify recombinant blue-light absorbing proteorhodopsin for experimental studies?

Recombinant BPR can be expressed using a pET28a vector containing the BPR gene in Escherichia coli host cells . For purification, immobilized metal-ion affinity chromatography (IMAC) has been successfully employed . The detailed methodology involves:

  • Constructing a suitable expression vector with the BPR gene

  • Transforming E. coli cells with this vector

  • Inducing protein expression (typically with IPTG)

  • Cell lysis and membrane fraction isolation

  • Solubilization of membrane proteins using appropriate detergents

  • Purification via IMAC using the histidine tag on the recombinant protein

  • Optional further purification steps such as size exclusion chromatography

For crystallization studies, the vapor-diffusion method has been successful with the BPR D97N mutant protein .

What are the key amino acid residues that determine the spectral tuning of blue-light absorbing proteorhodopsin?

The spectral tuning of BPR is determined by several key amino acid residues that influence the electronic environment of the retinal chromophore. Molecular orbital studies have identified four critical residues that play important, and in some cases pH-dependent, roles in wavelength regulation: Arg-95, Gln-106, Glu-143, and Asp-229 . These residues affect the electrostatic environment around the chromophore, influencing its absorption properties.

The significant red shift (0.22 eV) observed in BPR at low pH is likely due to a mechanism in which Glu-143 becomes protonated, releasing Arg-95 to rotate up into the binding site, thereby altering the electrostatic environment of the chromophore . This molecular mechanism explains the unusually large pH dependence of BPR's absorption spectrum.

How does the tertiary structure of blue-light absorbing proteorhodopsin compare to other rhodopsins?

Homology modeling studies have revealed that the tertiary structure of BPR is more realistically modeled using sensory rhodopsin II (SRII) rather than bacteriorhodopsin (BR) as a template . This structural similarity to SRII is significant because it raises questions about whether BPR primarily functions as a proton pump, as commonly believed, or possibly as a light sensor with structure-function properties more comparable to SRII .

More recent studies on mirror proteorhodopsins, which are functionally related to BPR but operate specifically at acidic pH, have shown a cavity/gate architecture in their proton translocation pathway that more closely resembles channelrhodopsins than conventional rhodopsin proton pumps . This suggests structural diversity exists within the broader proteorhodopsin family that relates to their functional adaptations.

What crystallization conditions are optimal for structural studies of recombinant blue-light absorbing proteorhodopsin?

For crystallization of BPR, the vapor-diffusion method has proven successful, particularly with the D97N mutant (BPR_D97N) . The crystals obtained belonged to the orthorhombic space group P212121, with unit-cell parameters a = 161.6, b = 168.6, c = 64.7 Å . These crystals diffracted to 3.3 Å resolution using synchrotron radiation.

For experimental phasing, selenomethionine-substituted protein crystals have been prepared, which diffracted to 3.0 Å resolution . Heavy-atom substructure determination and phasing by SAD (Single-wavelength Anomalous Diffraction) revealed that the crystal contained five molecules in the asymmetric unit, with a VM of 3.26 Å3 Da−1 and a solvent content of 62.3% .

Researchers should consider the following factors when optimizing crystallization conditions:

  • Detergent type and concentration

  • Protein concentration

  • Precipitant type and concentration

  • pH range (particularly important given BPR's pH sensitivity)

  • Additive screening

  • Temperature

What spectroscopic techniques are most informative for studying the photocycle of blue-light absorbing proteorhodopsin?

To effectively study the photocycle of BPR, several complementary spectroscopic techniques can be employed:

  • Time-resolved UV-visible absorption spectroscopy: Essential for tracking the formation and decay of photointermediates in the microsecond to second timescale.

  • FTIR (Fourier-transform infrared) spectroscopy: Provides information about protein conformational changes and protonation/deprotonation events during the photocycle.

  • Resonance Raman spectroscopy: Particularly useful for examining the configuration and environment of the retinal chromophore.

  • Flash photolysis: Allows measurement of the kinetics of photointermediate formation and decay.

  • pH-dependent spectroscopy: Critical for BPR due to its unusually large pH dependence, allowing researchers to monitor how the photocycle changes under different pH conditions .

These techniques should be applied across a range of pH values given BPR's significant spectral shifts between acidic and alkaline conditions.

How does the proton-pumping mechanism of blue-light absorbing proteorhodopsin differ at varying pH levels?

The proton-pumping mechanism of BPR exhibits significant pH dependence, which correlates with its spectral shifts. At high pH, BPR has spectroscopic properties similar to SRII, while at low pH, its properties more closely resemble bacteriorhodopsin . This suggests potential differences in the proton-pumping mechanism under different pH conditions.

The discovery of "mirror proteorhodopsins" has provided additional insights into pH-dependent proton pumping. Unlike conventional proteorhodopsins that function optimally at neutral and alkaline pH, mirror proteorhodopsins operate specifically as outward proton pumps at acidic pH . These mirror proteorhodopsins have a cavity/gate architecture in their proton translocation pathway that resembles channelrhodopsins rather than typical rhodopsin proton pumps .

The pH-dependent functional differences are likely related to key amino acid residues, particularly those involved in proton acceptance and donation. The proposed model for BPR suggests that at low pH, Glu-143 becomes protonated, allowing Arg-95 to rotate into the binding site and alter the chromophore's electrostatic environment . These structural changes likely affect not only absorption properties but also the efficiency and directionality of proton transport.

What are the potential applications of recombinant blue-light absorbing proteorhodopsin in optogenetics?

Recombinant BPR holds significant potential for optogenetic applications due to its ability to function as a light-driven proton pump. The pH-dependent properties of proteorhodopsins make them particularly interesting tools for optogenetics, as they could allow for selective control of cellular functions under specific pH conditions.

Mirror proteorhodopsins, which are functionally related to BPR but operate specifically at acidic pH, have already been demonstrated to modify lysosomal pH when expressed in HEK293T cells . This suggests potential applications for studying and manipulating pH-dependent cellular processes.

The complementary pH selectivity of conventional proteorhodopsins and mirror proteorhodopsins offers a unique toolset for optogenetic applications. For instance, co-expression of both types in lysosomes could enable precise, light-dependent control of organelle pH across different physiological states . This could be valuable for studying conditions where lysosomal pH dysregulation is implicated, such as certain neurodegenerative diseases.

How does the ecological distribution of blue-light absorbing proteorhodopsin variants correlate with marine environmental factors?

The ecological distribution of BPR variants is influenced by several environmental factors, particularly light availability at different ocean depths. Blue light penetrates deeper into the water column than other wavelengths, making BPR particularly advantageous for bacteria in deeper ocean layers.

The ability of proteorhodopsin-equipped bacteria to switch to light-based energy harvesting when oxygen respiration is impaired explains their abundance in oxygen-depleted "dead zones" in oceans . This adaptation provides a significant survival advantage in these challenging environments.

Different proteorhodopsin variants appear to have evolved to optimize light harvesting based on local light conditions. Green-absorbing proteorhodopsins are typically found in bacteria near the ocean surface, while blue-absorbing variants predominate in deeper waters where only blue light penetrates.

The more recently discovered mirror proteorhodopsins, which function optimally at acidic pH, have been found in specific bacterial genera including Sphingomonas, Patonea, and Pseudomonas . Interestingly, many of these bacteria are opportunistic pathogens, suggesting that mirror proteorhodopsins may provide advantages in acidic microenvironments encountered during infection or in specific ecological niches.

What strategies can overcome expression and folding challenges when producing recombinant blue-light absorbing proteorhodopsin?

Expressing functional recombinant BPR presents several challenges due to its membrane protein nature and requirement for proper retinal incorporation. Here are strategies to overcome these challenges:

  • Expression system optimization:

    • Use specialized E. coli strains designed for membrane protein expression (C41, C43, or Lemo21)

    • Consider alternate expression hosts such as Pichia pastoris for potentially better folding

    • Optimize induction conditions (temperature, inducer concentration, duration)

  • Improving protein folding:

    • Add all-trans retinal during expression (typically 5-10 μM)

    • Include chemical chaperones such as glycerol or specific lipids in the growth medium

    • Use lower expression temperatures (16-20°C) to slow protein production and facilitate proper folding

  • Solubilization and purification:

    • Screen multiple detergents for optimal solubilization (DDM, LDAO, OG)

    • Consider using amphipols or nanodiscs for improved stability

    • Incorporate a well-designed purification tag system that can be removed without affecting protein function

  • Functional verification:

    • Measure absorbance spectra to confirm proper chromophore incorporation

    • Perform pH titrations to verify the characteristic pH-dependent spectral shifts

    • Assess proton pumping activity in reconstituted systems

How can researchers accurately measure and quantify the proton-pumping activity of recombinant blue-light absorbing proteorhodopsin?

Accurate measurement of BPR's proton-pumping activity requires careful experimental design. Here are methodological approaches:

  • Reconstituted proteoliposome assays:

    • Reconstitute purified BPR into liposomes with controlled lipid composition

    • Monitor pH changes using pH-sensitive dyes (e.g., pyranine) trapped inside liposomes

    • Illuminate samples with blue light (λmax ~490 nm) while recording absorbance changes of the pH indicator

  • Whole-cell measurements:

    • Express BPR in E. coli cells lacking native proton pumps

    • Monitor light-induced pH changes in the external medium using a pH electrode

    • Correlate proton pumping with light intensity and spectral quality

  • Patch-clamp electrophysiology:

    • Express BPR in mammalian cells or Xenopus oocytes

    • Measure light-induced currents under voltage-clamp conditions

    • Determine ionic selectivity through ion substitution experiments

  • Important controls and considerations:

    • Include inhibitors of other proton transport systems

    • Test activity across a range of pH values (pH 4-9)

    • For mirror proteorhodopsins, test the effect of zinc, which has been shown to inhibit their proton pumping at millimolar concentrations

    • Measure activity using different wavelengths to confirm spectral sensitivity

    • Use appropriate non-functional mutants (e.g., D97N) as negative controls

How have blue-light absorbing proteorhodopsins evolved compared to green-light absorbing variants?

The evolutionary divergence between blue-light absorbing proteorhodopsins (BPRs) and green-light absorbing proteorhodopsins (GPRs) represents a fascinating example of spectral tuning adaptation to different light environments in marine ecosystems.

BPRs have evolved to capture blue light (absorption maximum around 490 nm) that penetrates deeper into the water column, while GPRs are optimized for green light (absorption maximum around 525 nm) that predominates in surface waters. This spectral tuning is primarily achieved through modifications in key amino acid residues surrounding the retinal binding pocket.

Molecular orbital calculations have identified specific residues (including Arg-95, Gln-106, Glu-143, and Asp-229 in BPR) that play crucial roles in wavelength regulation . The evolutionary selection of these residues likely occurred as bacterial populations adapted to specific depth ranges in the ocean water column.

The distinct pH dependencies of different proteorhodopsin variants suggest adaptation to microenvironments with varying pH conditions. BPR exhibits an unusually large pH dependence in its absorption spectrum , while the recently discovered mirror proteorhodopsins function optimally at acidic pH . These different pH optima may reflect adaptation to specific ecological niches or bacterial lifestyles.

What can structural comparisons between blue-light absorbing proteorhodopsin and sensory rhodopsin II tell us about their functional differences?

Structural comparisons between BPR and sensory rhodopsin II (SRII) provide valuable insights into their functional relationships and differences. Homology modeling studies have shown that SRII serves as a better structural template for BPR than bacteriorhodopsin (BR), with respect to free energy, dynamic stability, and spectroscopic properties .

Key differences to consider:

  • Functional role: While BPR is primarily described as a proton pump, its structural similarity to SRII raises questions about whether it might also have sensory functions . SRII functions as a photoreceptor involved in negative phototaxis rather than as an ion pump.

  • Photocycle intermediates: Comparative analysis of photocycle intermediates between BPR and SRII can reveal mechanistic differences in how these proteins respond to light activation.

  • Signal transduction: SRII typically interacts with transducer proteins to mediate phototaxis, while BPR is generally thought to function independently as an ion pump. Structural analysis of potential protein-protein interaction surfaces could reveal whether BPR retains any capability for signal transduction.

  • Spectral tuning: Both BPR and SRII absorb blue light, suggesting convergent evolution of their chromophore environments despite their different phylogenetic origins. Detailed comparison of their retinal binding pockets can identify common structural features that enable blue light absorption.

The functional implications of these structural similarities remain an active area of research and may lead to revised understanding of BPR's physiological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.