Recombinant Bolomys lactens NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Characterization

The protein is expressed in E. coli with an N-terminal His-tag for purification. Key specifications include:

ParameterDetail
Source OrganismNecromys lactens (Rufous-bellied bolo mouse)
Expression SystemE. coli
Purity>90% (SDS-PAGE verified)
Molecular Weight~13 kDa (theoretical)
StorageLyophilized in Tris/PBS buffer (pH 8.0) with 6% trehalose; -20°C/-80°C
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for stability
Data derived from .

Clinical and Research Implications

MT-ND3 mutations are linked to mitochondrial disorders, including:

  • Leigh syndrome: A 10197G>A mutation (A47T substitution) disrupts complex I activity, correlating with severe neurodegeneration .

  • Leber hereditary optic neuropathy (LHON): Impaired electron transport causes optic atrophy and vision loss .

  • Parkinson’s disease: Associations with mitochondrial dysfunction highlight MT-ND3’s role in neuronal energy metabolism .

Studies using recombinant MT-ND3 enable functional analyses of these mutations. For example, heteroplasmy levels >85% in patient muscle tissues correlate with disease severity .

Key Applications:

  • SDS-PAGE analysis: Purity validation and structural studies .

  • Antibody production: Used to generate polyclonal antibodies for immunohistochemistry (IHC) and immunocytochemistry (ICC) .

  • Disease modeling: Cybrid cell lines transfer mutant MT-ND3 to study biochemical defects .

Stability Notes:

  • Avoid repeated freeze-thaw cycles; aliquot for long-term storage .

  • Working aliquots stored at 4°C maintain functionality for ≤1 week .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: Our standard shipping includes normal blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Necromys lactens (Rufous-bellied bolo mouse) (Bolomys lactens)
Target Names
Target Protein Sequence
MNMILTLFINITLSLCLISIAFWLPQLNAYTEKASPYECGFDPMSSARLPFSMKFFLVGI TFLLFDLEIALLLPLPWAIHSTNSYLTMTVSFMLVSALALGLAYEWLNKGLEWTE
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. This protein is essential for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does MT-ND3 integrate into the mitochondrial electron transport chain?

MT-ND3 functions as a crucial subunit of NADH-ubiquinone oxidoreductase (Complex I), the first enzyme in the mitochondrial respiratory chain. This complex catalyzes electron transfer from NADH to ubiquinone, contributing to the proton gradient necessary for ATP synthesis .

Methodologically, researchers studying MT-ND3's integration can employ techniques such as blue native electrophoresis to visualize intact complexes, followed by Western blotting with MT-ND3-specific antibodies. Membrane topology studies using protease protection assays can further elucidate how MT-ND3 is arranged within the inner mitochondrial membrane .

What role does MT-ND3 play in reactive oxygen species (ROS) production?

MT-ND3, as part of Complex I, contributes to cellular ROS production, which has significant implications for oxidative stress and related pathologies. The mechanism involves two primary sites within Complex I where oxygen can be reduced to form superoxide:

  • Site associated with NADH oxidation in the mitochondrial matrix

  • Site associated with ubiquinone reduction in the membrane

Research methodology for studying MT-ND3's role in ROS production typically employs:

  • Spectrofluorometric assays using Amplex Red/horseradish peroxidase to detect H₂O₂

  • Dihydroethidium reduction assays to distinguish between superoxide and H₂O₂ production

  • Isolated Complex I experiments with varied NAD⁺/NADH ratios to establish potential dependence of ROS production

Data indicates that bacterial and mammalian Complex I exhibit differences in ROS production outcomes, with E. coli Complex I producing approximately 20% superoxide and 80% H₂O₂, while bovine Complex I produces approximately 95% superoxide . These differences may provide insights into MT-ND3's specific role in ROS generation mechanisms.

How can recombinant MT-ND3 be optimally produced and purified for structural studies?

For optimal production of recombinant MT-ND3:

  • Expression System: E. coli is the preferred expression system, allowing for high-yield production of this mitochondrial protein .

  • Purification Strategy:

    • Incorporate a His-tag (typically N-terminal) for affinity chromatography

    • Use immobilized metal affinity chromatography (IMAC) with Ni-NTA resin

    • Add 6% trehalose to storage buffers to maintain protein stability

    • Maintain pH at approximately 8.0 in Tris/PBS-based buffer systems

  • Storage Considerations:

    • Store as lyophilized powder or in aliquots at -20°C/-80°C

    • Add 5-50% glycerol (final concentration) for long-term storage

    • Reconstitute to 0.1-1.0 mg/mL in deionized sterile water before use

    • Avoid repeated freeze-thaw cycles

Researchers should validate protein purity via SDS-PAGE (>90% purity is typical for functional studies) and verify activity through appropriate enzyme assays.

Which MT-ND3 polymorphisms have been associated with disease risk?

Several single nucleotide polymorphisms (SNPs) in MT-ND3 have been linked to disease susceptibility:

SNP IdentifierDisease AssociationMechanismReference
rs41467651Gastric cancer (GC)T allele increases risk (adjusted OR = 2.11, 95% CI = 1.25-3.55, P = 0.005)
rs28358278Gastric cancer (GC) in femalesG allele increases risk (adjusted OR = 1.70, 95% CI = 1.08-2.69, P = 0.023)
rs2853826Gastric cancer (GC) in females; Type 2 diabetesT allele increases GC risk (adjusted OR = 1.78, 95% CI = 1.11-2.85, P = 0.016); Increases ROS production in T2DM

Research methodologies for associating these polymorphisms with disease typically involve:

  • Case-control studies with direct sequencing

  • Stratified analysis by demographic and clinical parameters

  • Statistical adjustment for confounding factors

  • Functional validation through cellular assays measuring ROS production, mitochondrial membrane potential, or ATP synthesis

How do genetic variations in MT-ND3 influence high-altitude adaptation?

MT-ND3 genetic variations have been implicated in high-altitude adaptation mechanisms, particularly in species like Tibetan yaks and cattle. Specific findings include:

  • Negative associations with high-altitude adaptation:

    • SNPs m.9893 A>G, m.9932 A>C, and m.10155 C>T (p < 0.003)

    • Haplotype H3 shows negative association with adaptation (p < 0.0014)

  • Positive associations with high-altitude adaptation:

    • SNP m.10073 C>T shows positive association (p < 0.0006)

    • Haplotypes H1 and H5 in MT-ND3 show positive associations with high-altitude adaptability

These genetic variations likely influence the efficiency of the electron transport chain under hypoxic conditions, affecting mitochondrial respiration and ATP production in low-oxygen environments. Research approaches typically involve:

  • Comparative sequencing across altitude-adapted and non-adapted populations

  • Haplotype analysis and association studies

  • Functional characterization of specific variants through oxygen consumption and ATP production assays under normoxic and hypoxic conditions

How can MT-ND3 be used to investigate mitochondrial contributions to cancer progression?

MT-ND3 serves as an excellent model for studying mitochondrial contributions to cancer due to its involvement in ROS production and energy metabolism. Advanced research applications include:

  • Tumor Microenvironment Studies:

    • Investigating how MT-ND3 variants influence adaptation to hypoxic tumor environments

    • Measuring differences in ROS production in cancer vs. normal tissues

  • Methodological Approaches:

    • CRISPR/Cas9-mediated introduction of specific MT-ND3 mutations in cell lines

    • Seahorse XF analysis to measure respiratory capacity changes

    • Live cell imaging with ROS-sensitive fluorescent probes

    • mtDNA sequencing of patient tumors to identify MT-ND3 variants

  • Clinical Correlations:

    • Association studies between MT-ND3 variants and clinical parameters like tumor stage, lymph node metastasis, and survival

    • Development of MT-ND3-based biomarkers for cancer prognostication

The rs41467651 polymorphism in MT-ND3, for example, has been significantly associated with gastric cancer risk in stage III tumors (adjusted OR = 2.36, 95% CI = 1.12-5.13, P = 0.025), suggesting stage-specific effects that could inform both basic research and clinical applications .

What experimental approaches can resolve contradictions in MT-ND3 ROS production data?

Contradictory findings regarding ROS production mechanisms involving MT-ND3 remain a challenge. Advanced experimental approaches to resolve these contradictions include:

  • Redox Potential Manipulation:

    • Using precise NAD⁺/NADH ratios to set the redox potential

    • Measuring ROS production rate as a function of potential to identify site-specific contributions

  • Site-Specific Mutagenesis:

    • Introducing mutations at potential O₂ reduction sites

    • Comparing wild-type and mutant proteins for altered ROS production patterns

  • Species-Comparative Studies:

    • Comparing MT-ND3 from E. coli (producing 20% superoxide/80% H₂O₂) with bovine MT-ND3 (producing 95% superoxide)

    • Creating chimeric proteins to identify domains responsible for differences in ROS species generation

  • Advanced Detection Methods:

    • Electron paramagnetic resonance (EPR) spectroscopy to detect radical intermediates

    • Mass spectrometry to identify oxidatively modified residues

    • Real-time superoxide detection using genetically encoded sensors

These approaches can help determine whether the fully reduced flavin mononucleotide or other sites like the [2Fe-2S] cluster N1a are responsible for oxygen reduction, resolving current mechanistic uncertainties .

How might MT-ND3 be utilized in studying mitochondrial adaptation to extreme environments?

MT-ND3's involvement in high-altitude adaptation makes it a valuable model for studying mitochondrial responses to extreme environments. Emerging research approaches include:

  • Comparative Genomics and Proteomics:

    • Sequence analysis across species adapted to different environments (high-altitude, deep-sea, extreme temperatures)

    • Identifying convergent evolutionary changes in MT-ND3 structure

  • Experimental Methods:

    • Respirometry under simulated extreme conditions (hypoxia, pressure, temperature)

    • In vitro reconstitution of Complex I with variant MT-ND3 proteins

    • Measurement of proton pumping efficiency using pH-sensitive fluorescent probes

  • Physiological Integration:

    • Correlating MT-ND3 variants with whole-organism adaptations

    • Transgenic models expressing environment-specific MT-ND3 variants

The study of Tibetan yaks and cattle has revealed specific haplotypes (H1 and H5) in MT-ND3 that show positive associations with high-altitude adaptability, while others (H3) show negative associations, providing a natural model system for understanding how mitochondrial genes contribute to environmental adaptation .

What are the methodological challenges in studying MT-ND3 interactions with nuclear-encoded Complex I subunits?

Investigating interactions between mitochondrial-encoded MT-ND3 and nuclear-encoded Complex I subunits presents significant methodological challenges:

  • Technical Limitations:

    • Difficulty in simultaneously manipulating mitochondrial and nuclear genomes

    • Limited availability of cybrid cell models specific to MT-ND3 variants

    • Challenges in reconstituting functional Complex I in vitro

  • Advanced Approaches:

    • Crosslinking mass spectrometry to identify interaction interfaces

    • Cryo-electron microscopy of assembled Complex I with variant MT-ND3

    • In silico molecular dynamics simulations of subunit interactions

    • Mitochondria-targeted CRISPR systems for MT-ND3 editing

  • Integration Strategies:

    • Multi-omics approaches combining proteomics, transcriptomics, and metabolomics

    • Functional assays measuring assembly efficiency, stability, and activity of Complex I

What are the most promising therapeutic applications targeting MT-ND3 dysfunction?

While MT-ND3 dysfunction has been implicated in various diseases, therapeutic targeting remains challenging. Current research focuses on:

  • Precision Medicine Approaches:

    • Identifying patient-specific MT-ND3 variants for targeted interventions

    • Developing biomarkers based on MT-ND3 variants for disease risk stratification

  • Therapeutic Strategies:

    • Mitochondria-targeted antioxidants to counteract increased ROS from MT-ND3 dysfunction

    • Small molecules that stabilize Complex I assembly despite MT-ND3 variations

    • Gene therapy approaches for nuclear-encoded compensatory proteins

  • Future Research Directions:

    • High-throughput screening for compounds that specifically modulate MT-ND3 function

    • Development of MT-ND3-focused mitochondrial replacement therapies

    • Investigation of dietary interventions that may optimize electron flow through Complex I

The association of specific MT-ND3 polymorphisms with diseases such as gastric cancer suggests potential for developing targeted screening programs or preventive interventions for individuals carrying high-risk variants .

How will advances in structural biology enhance our understanding of MT-ND3 function?

Recent advances in structural biology techniques are revolutionizing our understanding of MT-ND3:

  • Current Limitations:

    • Insufficient resolution of MT-ND3 in existing Complex I structures

    • Challenges in crystallizing isolated MT-ND3 due to its hydrophobicity

    • Limited understanding of conformational changes during catalysis

  • Emerging Technologies:

    • Cryo-electron microscopy at sub-2Å resolution revealing atomic details

    • Integrative structural biology combining multiple experimental approaches

    • Time-resolved structural methods capturing dynamic conformational states

    • Computational approaches predicting variant-specific structural changes

  • Anticipated Breakthroughs:

    • Detailed mapping of MT-ND3's role in proton pumping mechanisms

    • Structural basis for how specific polymorphisms affect Complex I assembly and function

    • Complete atomic-level understanding of MT-ND3's interactions with both mitochondrial and nuclear-encoded subunits

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.