Recombinant Bombina orientalis [Phe13]-bombesin receptor (BB4)

Shipped with Ice Packs
In Stock

Description

Overview of BB4

The Recombinant Bombina orientalis [Phe13]-bombesin receptor (BB4) is a G-protein-coupled receptor (GPCR) cloned from the brain of Bombina orientalis (Oriental fire-bellied toad). It is a distinct subtype of bombesin receptors, showing higher affinity for [Phe13]-bombesin (a tetradecapeptide isolated from amphibian skin) compared to other bombesin-like peptides such as gastrin-releasing peptide (GRP) or neuromedin B (NMB) . BB4 is expressed exclusively in the brain, aligning with the distribution of its endogenous ligand, [Phe13]-bombesin .

Binding Affinity and Rank Potency

BB4 exhibits distinct pharmacological specificity compared to other bombesin receptors.

PeptideKi (nM) for BB4Ki (nM) for GRP ReceptorRelative Potency (BB4 vs. GRP)
[Phe13]-bombesin0.22.1Highest affinity
[Leu13]-bombesinNot reportedGRP > [Leu13]-bombesin > [Phe13]-bombesin Lower affinity than GRP receptor
GRP2.1 (Ki for GRP receptor)N/APartial agonist/antagonist
Neuromedin BWeak responseWeak responseLowest affinity

Key Finding: BB4 binds [Phe13]-bombesin with 10-fold higher affinity than GRP, confirming it as the primary receptor for this peptide .

Phylogenetic and Evolutionary Insights

Phylogenetic analysis indicates that BB4 diverged from GRP and NMB receptors before their separation, suggesting ancient evolutionary divergence . This implies that analogous BB4 receptors and [Phe13]-bombesin-like ligands may exist in mammals, though their identification remains pending .

Recombinant Production and Applications

Recombinant BB4 is produced in various systems for experimental use:

Host SystemPurity (SDS-PAGE)Applications
E. coli≥85%Structural studies, ligand binding assays
Yeast/Baculovirus≥85%Functional expression in heterologous systems
Mammalian cells≥85%Signaling pathway analysis

Recombinant BB4 is commercially available as His-tagged full-length protein (1–392 amino acids) or partial fragments .

Antagonist Interactions

The GRP antagonist [D-Phe6]bombesin-(6-13) propylamide shows reduced efficacy against BB4:

  • Ki for BB4: ~2.0 nM (vs. GRP receptor: ~2.1 nM) .

  • Mechanism: Partial agonist activity observed, consistent with its weaker affinity for BB4 .

Implications and Future Directions

  • Mammalian Homologs: BB4’s evolutionary divergence suggests potential for undiscovered mammalian bombesin receptor subtypes with therapeutic relevance .

  • Functional Roles: BB4’s brain-specific expression hints at roles in neuroendocrine regulation, though precise physiological functions remain uncharacterized .

  • Drug Development: BB4’s high affinity for [Phe13]-bombesin makes it a target for developing peptide-based therapies, though antagonist selectivity challenges persist .

References

  1. Nagalla SR et al. (1995). Proc Natl Acad Sci USA 92(13):6205-6209 .

  2. MyBioSource (2014). Recombinant BB4 product specifications .

  3. Creative BioMart (2024). BB4 recombinant protein data .

  4. PubMed (1995). Binding affinity and receptor distribution .

  5. XenBase (2000). Structural and pharmacological analysis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standard with blue ice packs. For dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in sterile deionized water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and protein stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
BB4; [Phe13]-bombesin receptor; Bombesin receptor subtype-4; BRS-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Bombina orientalis (Oriental fire-bellied toad)
Target Names
BB4
Target Protein Sequence
MPEGFQSLNQTLPSAISSIAHLESLNDSFILGAKQSEDVSPGLEILALISVTYAVIISVG ILGNTILIKVFFKIKSMQTVPNIFITSLAFGDLLLLLTCVPVDASRYIVDTWMFGRAGCK IISFIQLTSVGVSVFTLTVLSADRYRAIVKPLQLQTSDAVLKTCGKAVCVWIISMLLAAP EAVFSDLYEFGSSEKNTTFEACAPYPVSEKILQETHSLICFLVFYIVPLSIISAYYFLIA KTLYKSTFNMPAEEHTHARKQIESRKRVAKTVLVLVALFAVCWLPNHMLYLYRSFTYHSA VNSSAFHLSATIFARVLAFSNSCVNPFALYWLSRSFRQHFKKQVYCCKTEPPASQQSPTH SSTITGITAVKGNIQMSEISITLLSAYDVKKE
Uniprot No.

Target Background

Function
The relative rank potency of bombesin-like peptides for this receptor is [Phe13]bombesin > [Leu13]bombesin > GRP > neuromedin-B.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed only in brain, primarily in cortex and forebrain and at low levels in the midbrain.

Q&A

What is the BB4 receptor and how was it initially identified?

The BB4 receptor is a bombesin receptor subtype with higher affinity for bombesin than for gastrin-releasing peptide (GRP). It was initially identified through PCR amplification of cDNAs related to known bombesin receptors from frog brain tissue. Sequence analysis of these amplified cDNAs revealed three distinct classes of receptor subtypes, with two classes clearly representing amphibian homologs of the GRP and neuromedin B receptors. The third class, subsequently designated as BB4, represented a novel receptor subtype from which a full-length clone was isolated from a Bombina orientalis brain cDNA library .

The identification process involved several methodological steps, including:

  • Targeted PCR amplification using primers designed based on conserved regions of known bombesin receptors

  • Sequence analysis to differentiate receptor subtypes

  • Isolation of a full-length clone from a specialized cDNA library

  • Functional expression studies to confirm ligand binding properties

This systematic approach established BB4 as a distinct bombesin receptor subtype with unique pharmacological characteristics and evolutionary significance .

What is the binding profile of the BB4 receptor compared to other bombesin receptor subtypes?

The BB4 receptor exhibits a distinctive binding profile that differentiates it from other bombesin receptor subtypes. Expression studies in Xenopus oocytes demonstrated that the BB4 receptor responds to picomolar concentrations of [Phe13]-bombesin, the form most prevalent in frog brain . The relative rank potency of bombesin-like peptides for this receptor follows a specific hierarchy:

LigandRelative Potency for BB4Ki Value for BB4
[Phe13]bombesinHighest0.2 nM
[Leu13]bombesinHighNot specified
GRPModerate2.1 nM
Neuromedin BLowestNot specified

This pattern contrasts sharply with the GRP receptor binding profile, where the rank potency is GRP > [Leu13]bombesin > [Phe13]bombesin > neuromedin B . Transient expression studies in CHOP cells confirmed these findings, showing a Ki for [Phe13]bombesin of 0.2 nM versus a Ki of 2.1 nM for GRP, indicating approximately 10-fold higher affinity for [Phe13]bombesin .

These pharmacological differences reflect structural variations in the ligand binding domains of the respective receptors and provide valuable tools for discriminating between receptor subtypes in experimental settings.

What is the tissue distribution pattern of BB4 receptors in amphibians?

Distribution analysis of the BB4 receptor revealed a highly specific expression pattern limited to the brain in amphibians, which aligns perfectly with the distribution of its preferred ligand, [Phe13]-bombesin . This restricted expression pattern contrasts with the wider distribution of other bombesin receptor subtypes and strongly suggests a specialized neurological function for the BB4 receptor in amphibian physiology.

The brain-specific localization of BB4 receptors suggests several important research considerations:

  • BB4 may be involved in specialized neural circuits unique to amphibians

  • The receptor likely mediates specific neurobiological processes that are distinct from those regulated by GRP or neuromedin B receptors

  • Experimental approaches targeting BB4 should focus on neuronal systems rather than peripheral tissues

This specific tissue distribution pattern provides critical contextual information for designing relevant experimental models and interpreting functional data related to BB4 receptor signaling .

What methodologies are most effective for expressing recombinant BB4 receptors in experimental systems?

Successful expression of recombinant BB4 receptors requires careful consideration of the expression system based on experimental objectives. The original characterization of BB4 employed two distinct expression systems, each with specific advantages:

  • Xenopus oocyte expression system:

    • Ideal for electrophysiological studies

    • Allows measurement of receptor-activated ion channel responses

    • Demonstrated picomolar sensitivity to [Phe13]-bombesin

    • Suitable for comparing pharmacological profiles of different ligands

  • Mammalian cell expression (CHOP cells):

    • Appropriate for binding assays and determination of binding constants

    • Enabled precise measurement of Ki values (0.2 nM for [Phe13]bombesin versus 2.1 nM for GRP)

    • Allows investigation of mammalian-specific signaling pathways

    • More suitable for studies of receptor regulation and trafficking

For advanced structural studies, additional expression systems might be considered:

  • Insect cell/baculovirus systems for large-scale protein production

  • Stable mammalian cell lines for consistent expression levels

  • Cell-free systems for rapid screening of mutant receptors

The choice of expression system should align with specific research questions, with consideration given to post-translational modifications, membrane composition, and availability of signaling partners that might influence receptor function.

What are the evolutionary implications of BB4 receptor phylogeny?

Phylogenetic analysis suggests that the BB4 receptor separated prior to the divergence of the GRP and neuromedin B receptors, placing it at a particularly interesting position in the evolutionary history of bombesin receptors . This phylogenetic positioning has several profound implications for understanding GPCR evolution and comparative pharmacology:

  • The early separation of BB4 suggests it may represent a more ancestral form of bombesin receptors

  • The existence of BB4 in amphibians indicates evolutionary conservation of multiple bombesin receptor subtypes across vertebrate lineages

  • BB4 receptors and their cognate ligands may also exist in mammals, representing an unexplored area of bombesin receptor biology

This evolutionary perspective provides a framework for:

  • Identifying potential mammalian homologs through targeted genome analysis

  • Understanding the selective pressures driving bombesin receptor diversification

  • Contextualizing functional differences between receptor subtypes across species

Researchers investigating BB4 phylogeny should employ comprehensive phylogenetic methods incorporating sequence data from diverse species and consider both coding and regulatory regions to fully understand the evolutionary history of this receptor family.

What are the critical considerations when designing binding assays for BB4 receptors?

Designing robust binding assays for BB4 receptors requires careful attention to several experimental parameters to ensure reliable and reproducible results:

  • Radioligand selection:

    • Ideal primary radioligand: [125I]-[Phe13]-bombesin due to high affinity (Ki = 0.2 nM)

    • Alternative radioligands should be selected based on their known affinities for BB4

    • Consider specific activity and stability of labeled ligands

  • Membrane preparation:

    • Source tissue selection: recombinant expression systems preferred over native tissues due to low abundance in brain

    • Optimization of membrane isolation protocols to preserve receptor integrity

    • Validation of receptor density through saturation binding assays

  • Assay conditions optimization:

    • Buffer composition affects binding kinetics (pH, ionic strength, presence of divalent cations)

    • Temperature control (typically 25°C or 37°C) with consistent incubation times

    • Inclusion of protease inhibitors to prevent receptor degradation

  • Competition assay design:

    • Concentration range for competing ligands (10-12 to 10-6 M recommended)

    • Inclusion of [Phe13]bombesin, [Leu13]bombesin, GRP, and neuromedin B as reference compounds

    • Separation methods (filtration versus centrifugation) optimized for signal-to-noise ratio

  • Data analysis considerations:

    • Use of appropriate curve-fitting algorithms (one-site versus two-site binding models)

    • Transformation of IC50 values to Ki values using the Cheng-Prusoff equation

    • Statistical analysis of replicate experiments (minimum n=3)

Implementing these considerations ensures that binding data accurately reflects the pharmacological properties of the BB4 receptor and facilitates comparison with other bombesin receptor subtypes.

How should functional assays be designed to characterize BB4 receptor signaling pathways?

Functional characterization of BB4 receptor signaling requires carefully designed assays that can detect and quantify downstream signaling events. As a G protein-coupled receptor, BB4 likely activates multiple signaling pathways that should be systematically investigated:

  • G protein coupling assessment:

    • GTPγS binding assays to measure G protein activation

    • Selective G protein inhibitors to identify coupling preferences

    • BRET/FRET-based assays for real-time G protein association

  • Second messenger systems:

    • Calcium mobilization assays (similar to those used for pancreatic acinar cell responses to bombesin)

    • cAMP accumulation measurements using ELISA or reporter systems

    • IP3 formation assays (bombesin is known to activate IP pathways)

  • Downstream effector activation:

    • ERK1/2 phosphorylation through western blotting or ELISA

    • Protein kinase C translocation assays

    • Gene expression analysis using qPCR for known bombesin-responsive genes

  • Receptor regulation studies:

    • Internalization assays using fluorescently-labeled ligands

    • Phosphorylation state analysis using phospho-specific antibodies

    • Desensitization protocols with repeated ligand application

These functional assays should incorporate appropriate positive controls (other bombesin receptor subtypes with known signaling properties) and negative controls (untransfected cells or cells expressing mutant receptors). Dose-response relationships should be established across a wide concentration range (10-12 to 10-6 M) to fully characterize the potency and efficacy of [Phe13]-bombesin and related ligands.

How should researchers interpret contradictory findings between different experimental models of BB4 receptor function?

Contradictory findings between different experimental models studying BB4 receptors are not uncommon and require careful interpretation. When faced with discrepant results, researchers should consider several systematic factors that might explain the differences:

  • Expression system variations:

    • Different cell backgrounds provide varied G protein coupling efficiency

    • Receptor expression levels can dramatically affect apparent potency

    • Post-translational modifications may differ between expression systems

  • Species differences:

    • While the BB4 receptor was characterized in Bombina orientalis, homologs in other species may have subtle functional differences

    • Expression patterns may vary across species (the BB4 receptor is primarily expressed in brain in amphibians)

    • Signaling machinery efficiency may differ between species-derived cell lines

  • Methodological considerations:

    • Detection sensitivity varies between assay platforms

    • Temporal resolution differences may capture distinct signaling phases

    • Buffer compositions can significantly alter receptor-ligand interactions

When confronted with contradictory data, researchers should:

  • Directly compare experimental conditions and methodologies

  • Verify receptor expression and functionality in each system

  • Consider performing bridging studies using standardized conditions

  • Evaluate the biological relevance of each model to the research question

Understanding these factors helps contextualize contradictory findings and can transform apparent discrepancies into insights about receptor biology under different conditions.

What approaches should be used to distinguish direct BB4 receptor effects from indirect downstream consequences?

Distinguishing direct BB4 receptor-mediated effects from indirect downstream consequences requires a multi-faceted experimental approach:

  • Temporal resolution studies:

    • Rapid events (seconds to minutes) are more likely direct receptor effects

    • Delayed responses (hours) often involve transcriptional regulation

    • Time-course studies can establish causality between signaling events

  • Pharmacological tools:

    • Selective BB4 receptor antagonists (when available)

    • Pathway-specific inhibitors targeting intermediate signaling molecules

    • Use of structurally diverse BB4 agonists to establish receptor specificity

  • Genetic approaches:

    • Receptor knockdown/knockout using siRNA or CRISPR-Cas9

    • Expression of signaling-biased receptor mutants

    • Rescue experiments reintroducing wild-type or mutant receptors

  • Signal transduction bypass:

    • Direct activation of downstream effectors (e.g., PKC activators)

    • Constitutively active G protein subunit co-expression

    • Comparison of patterns produced by receptor-dependent versus independent activation

A systematic application of these approaches allows researchers to build a hierarchical map of signaling events, clearly delineating those directly coupled to BB4 receptor activation from secondary or tertiary consequences.

What is the evidence for BB4-like receptors in mammals and their potential physiological roles?

Phylogenetic analysis suggests that BB4 receptors separated prior to the divergence of GRP and neuromedin B receptors, raising the possibility that BB4-like receptors may exist in mammals . While direct evidence for mammalian BB4 homologs is limited in the available literature, several indirect lines of evidence support this hypothesis:

  • Evolutionary conservation patterns:

    • Bombesin-like peptides are well-conserved across vertebrate species

    • Multiple bombesin receptor subtypes exist in mammals (GRP-R, NMB-R, BRS-3)

    • Phylogenetic analyses suggest potential additional receptor subtypes

  • Pharmacological evidence:

    • Some bombesin-like effects in mammals cannot be fully explained by known receptor subtypes

    • Differential tissue responses to various bombesin analogs suggest receptor heterogeneity

    • Potential for orphan GPCRs that respond to bombesin-like peptides

  • Physiological implications:

    • If present, mammalian BB4-like receptors might regulate specialized neuronal functions

    • Could be involved in bombesin-induced pancreatic growth effects, as bombesin stimulates pancreatic growth in both adult and newborn rodents

    • Might participate in specialized neuroendocrine signaling pathways

Research strategies to identify potential mammalian BB4 homologs should include:

  • Genomic analyses searching for BB4-like sequences

  • Expression screening of orphan GPCRs using [Phe13]-bombesin as a probe

  • Tissue-specific transcriptomic analyses focusing on brain regions

  • Functional screening for [Phe13]-bombesin preferring binding sites

The identification of mammalian BB4-like receptors would significantly enhance our understanding of the bombesin receptor family and potentially reveal new therapeutic targets.

How can BB4 receptor research inform the development of selective bombesin receptor ligands?

Research on the BB4 receptor provides valuable insights for developing selective ligands targeting specific bombesin receptor subtypes, with implications for both research tools and potential therapeutics:

  • Structure-activity relationship insights:

    • The preference of BB4 for [Phe13]-bombesin over other bombesin-like peptides highlights the importance of the C-terminal amino acid

    • Comparison of binding profiles between BB4, GRP-R, and NMB-R can identify key residues for subtype selectivity

    • Molecular modeling of the BB4 binding pocket can guide rational design of selective ligands

  • Cross-species conservation considerations:

    • Understanding how ligand preferences vary across species helps predict clinical translation

    • Conservation of binding pocket architecture between amphibian and mammalian receptors informs peptide design

    • Identification of invariant binding determinants across species suggests essential pharmacophore elements

  • Therapeutic potential areas:

    • Selective bombesin receptor ligands have potential applications in:

      • Neurological disorders (bombesin affects multiple CNS functions)

      • Pancreatic disorders (bombesin stimulates pancreatic growth and enzyme secretion)

      • Gastrointestinal motility regulation

      • Cancer diagnostics and treatment (bombesin receptors are overexpressed in certain tumors)

  • Methodological applications:

    • Development of selective antagonists as pharmacological tools

    • Creation of fluorescently-labeled selective ligands for receptor visualization

    • Design of biased ligands that activate specific signaling pathways

The unique pharmacological profile of the BB4 receptor offers valuable benchmarks for assessing the selectivity of novel compounds and informs the design of next-generation bombesin receptor ligands with enhanced subtype specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.