Recombinant Bombyx mori 5-hydroxytryptamine receptor

Shipped with Ice Packs
In Stock

Description

Functional and Pharmacological Profile

Research on related serotonin receptors in Bombyx mori highlights their role in modulating physiological processes:

Immune Regulation

Serotonin (5-HT) in insects regulates hemocyte phagocytosis, a key immune response mechanism. Studies in Drosophila melanogaster and Pieris rapae demonstrate that 5-HT signaling via 5-HT1B and 5-HT2B receptors enhances phagocytosis during bacterial infections . While the recombinant protein’s specific subtype is not explicitly defined in product specifications, its structural homology to these receptors suggests potential utility in studying immune-related signaling.

Locomotion and Behavior

In Bombyx mori, the 5-HT1A receptor subtype (a homolog of the recombinant protein) is linked to locomotor activity. Pharmacological studies reveal:

  • Agonists: Pimozide > 8-OH-DPAT > 5-MeOT ~ α-m-5-HT (EC₅₀ = 117 nM for 5-HT) .

  • Antagonists: WAY-100635 > prazosin > SB-269970 > methiothepin .

  • Functional Impact: Antagonist injection reduces larval motility and adult courtship activity, while RNAi-mediated knockdown of Bm5-HT1A lowers locomotion .

Signaling Mechanisms

The recombinant protein’s activity is characterized by its inhibition of forskolin-stimulated cAMP synthesis, a hallmark of Gαi/o-coupled 5-HT receptors. This aligns with the 5-HT1A receptor’s role in reducing intracellular cAMP levels in HEK 293 cell models .

Research Applications

The recombinant protein serves as a versatile tool in molecular biology and pharmacology:

ApplicationMethod/Use Case
Structure-Function StudiesX-ray crystallography or cryo-EM to map ligand-binding domains and conformational changes
ELISA AssaysDetection and quantification of 5-HT receptor levels in insect tissues or engineered systems
Pharmacological ScreeningTesting agonist/antagonist efficacy in insect serotonin pathways
Immune Response ModelingInvestigating 5-HT’s role in hemocyte phagocytosis and bacterial resistance

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing that specific tag.
Synonyms
5-hydroxytryptamine receptor; 5-HT receptor; Serotonin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
BOMMO(Silk moth)
Target Protein Sequence
MEGAEGQEELDWEALYLRLPLQNCSWNSTGWEPNWNVTVVPNTTWWQASAPFDTPAALVR AAAKAVVLGLLILATVVGNVFVIAAILLERHLRSAANNLILSLAVADLLVACLVMPLGAV YEVVQRWTLGPELCDMWTSGDVLCCTASILHLVAIALDRYWAVTNIDYIHASTAKRVGMM IACVWTVSFFVCIAQLLGWKDPDWNQRVSEDLRCVVSQDVGYQIFATASSFYVPVLIILI LYWRIYQTARKRIRRRRGATARGGVGPPPVPAGGALVAGGGSGGIAAAVVAVIGRPLPTI SETTTTGFTNVSSNNTSPEKQSCANGLEADPPTTGYGAVAAAYYPSLVRRKPKEAADSKR ERKAAKTLAIITGAFVACWLPFFVLAILVPTCDCEVSPVLTSLSLWLGYFNSTLNPVIYT VFSPEFRHAFQRLLCGRRVRRRRAPQ
Uniprot No.

Target Background

Function
This protein serves as a receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, hormone, and mitogen.
Database Links

KEGG: bmor:693054

STRING: 7091.BGIBMGA006929-TA

UniGene: Bmo.8

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.