Recombinant Bombyx mori Allatostatin-A receptor (AR)

Shipped with Ice Packs
In Stock

Description

Functional Characterization

The recombinant receptor was functionally validated using Chinese hamster ovary (CHO) cells transfected with the BAR gene. Key findings include:

ParameterResult
Ligand SensitivityResponds to 4 × 10⁻⁹ M Bombyx allatostatin-A peptides
Signaling PathwayActivates Gαi/o-coupled pathways; inhibits cAMP production (indirect assay via bioluminescence)
Ligand SpecificityActivated by Bombyx AST-A peptides but not vertebrate GAL/KISS peptides

Functional assays revealed that BAR couples to Gαi/o proteins, initiating intracellular signaling cascades that modulate physiological processes such as gut motility and nutrient absorption .

Tissue-Specific Expression and Localization

Northern blot and quantitative reverse transcription-polymerase chain reaction (qRT-PCR) analyses demonstrated:

TissueExpression Level
GutHigh expression in larval stages
BrainLow expression, suggesting localized signaling in the CNS

This differential expression aligns with the receptor’s roles in gut physiology and neuroendocrine regulation .

Comparative Evolutionary Analysis

BAR shares structural and functional homology with receptors in other insects, particularly Drosophila melanogaster:

ReceptorSequence IdentityKey Features
DAR-1 (Drosophila)60%CNS-localized; regulates feeding behavior
DAR-2 (Drosophila)48%Gut-localized; modulates metabolic pathways
Cockroach AST-AR~50–60%Shared intron-exon structure; conserved FGL-amide binding

BAR retains conserved motifs (e.g., NSxxNPxxY in TM7) critical for ligand recognition, underscoring its evolutionary conservation .

Research Applications and Significance

The recombinant BAR has implications for:

  1. Pest Control: Targeting allatostatin signaling could disrupt feeding behavior in agricultural pests.

  2. Metabolic Regulation: Insights into how BAR modulates gut-brain axis signaling may inform metabolic disease models.

  3. Drug Development: Structural studies of BAR could guide the design of selective agonists/antagonists for insect-specific GPCRs.

Future Directions

Unresolved questions include:

  • Receptor Trafficking: Why BAR isoforms show variable cell surface localization?

  • Ligand Diversity: Does Bombyx produce additional AST-A peptides beyond the eight identified?

  • Cross-Talk Pathways: How does BAR interact with other neuropeptide systems (e.g., AKH, DILPs)?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate them when placing your order, and we will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
AR; Allatostatin-A receptor; BAR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
BOMMO(Silk moth)
Target Names
AR
Target Protein Sequence
MESTEDEFYTICLNLTAEDPSFGNCNYTTDFENGELLEKVVSRVVPIFFGFIGIVGLVGN ALVVLVVAANPGMRSTTNLLIINLAVADLLFVIFCVPFTATDYVMPRWPFGDWWCKVVQY FIVVTAHASVYTLVLMSLDRFMAVVHPIASMSIRTEKNALLAIACIWVVILTTAIPVGIC HGEREYSYFNRNHSSCVFLEERGYSKLGFQMSFFLSSYVIPLALISVLYMCMLTRLWKSA PGGRVSAESRRGRKKVTRMVVVVVVVFAVCWCPIQIILLVKALNKYHITYFTVTAQIVSH VLAYMNSCVNPVLYAFLSENFRVAFRKVMYCPPPYNDGFSGRPQATKTTRTGNGNSCHDI V
Uniprot No.

Target Background

Function
Functions as a receptor for A-type allatostatin neuropeptide hormones.
Database Links

KEGG: bmor:692587

STRING: 7091.BGIBMGA005708-TA

UniGene: Bmo.692

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the midgut and, to a lesser extent, in the fore- and hindgut of fifth instar larvae. Also highly expressed in the brain of fourth and fifth instar larvae.

Q&A

What is the molecular structure and characteristics of the Bombyx mori Allatostatin-A receptor?

The Bombyx mori Allatostatin-A receptor (BAR) is a G protein-coupled receptor that specifically binds A-type allatostatins, which are inhibitory neuropeptides characterized by the C-terminal sequence Tyr/Phe-X-Phe-Gly-Leu-NH₂. BAR consists of 361 amino acid residues and contains seven transmembrane domains typical of G protein-coupled receptors. The receptor shares significant sequence homology with Drosophila allatostatin receptors, demonstrating 60% amino acid identity with the first Drosophila allatostatin receptor (DAR-1) and 48% identity with the second Drosophila allatostatin receptor (DAR-2) .

At the genomic level, the BAR gene contains two introns and three exons. These introns coincide with and share the same phasing as two introns in the DAR-1 and DAR-2 genes, providing evidence that these receptors are not only structurally but also evolutionarily related . This conservation of intron positioning strongly suggests a common ancestral origin for these receptors across insect orders.

Functionally, BAR couples to G proteins and initiates second messenger cascades upon binding with A-type allatostatins. This has been demonstrated experimentally in Chinese hamster ovary cells permanently transfected with BAR DNA, which show a measurable response to Bombyx A-type allatostatins at concentrations as low as 4 × 10⁻⁹ M .

How is the Bombyx mori Allatostatin-A receptor expressed across different tissues and developmental stages?

Northern blot analysis and quantitative reverse transcriptase-polymerase chain reaction (RT-PCR) of different larval tissues have revealed that BAR mRNA is predominantly expressed in the gut and to a much lesser extent in the brain of Bombyx mori . This expression pattern differs somewhat from patterns seen in other insects and suggests specialized roles for allatostatin signaling in silkworm physiology, particularly in gut function.

The gut-predominant expression pattern suggests that BAR likely plays important roles in regulating digestive processes, gut motility, and possibly nutrient absorption. This distribution pattern aligns with the multifunctional nature of allatostatins, which can regulate various physiological processes beyond their namesake function of inhibiting juvenile hormone synthesis.

While the original research focused primarily on larval expression patterns, subsequent studies in related species suggest that expression levels may vary throughout development. In other lepidopterans like Pseudaletia unipuncta, allatostatin-related gene expression has been observed to be relatively low in late-stage larvae and prepupae but increases in late pupae and adults . This temporal regulation suggests developmental stage-specific functions for allatostatin signaling that may extend beyond the larval period into adult physiological processes.

What methods are most effective for molecular cloning and expression of recombinant Bombyx mori Allatostatin-A receptor?

Successful molecular cloning and expression of functional BAR requires careful methodology selection and optimization. Based on published approaches, the following methods have proven effective:

For molecular cloning:

  • RNA extraction from tissues with high BAR expression (primarily gut tissue) followed by cDNA synthesis using reverse transcriptase with oligo(dT) or random primers .

  • PCR amplification of the full-length BAR coding sequence using gene-specific primers designed based on the predicted or known sequence.

  • Cloning of the PCR product into appropriate vectors - initially into cloning vectors (like pGEM-T Easy) for sequence verification, followed by subcloning into expression vectors containing strong promoters (like CMV for mammalian expression).

  • Sequence verification through bidirectional DNA sequencing to ensure the absence of mutations.

For functional expression:

  • Chinese hamster ovary (CHO) cells have been successfully used for expressing functional BAR. These cells provide the appropriate membrane composition and cellular machinery for proper receptor insertion and function .

  • Stable transfection approaches yield more consistent results than transient transfection for functional studies.

  • Verification of receptor expression using techniques such as RT-PCR, Western blotting (if receptor-specific antibodies are available), or fluorescent tagging.

  • Functional assessment through second messenger assays, such as measuring bioluminescence indicative of signaling cascade activation upon stimulation with A-type allatostatins .

For optimal results, expression systems should be carefully selected based on the specific research questions being addressed, with mammalian systems generally providing the most physiologically relevant context for functional studies.

How does the Bombyx mori Allatostatin-A receptor compare to other insect allatostatin receptors?

The Bombyx mori Allatostatin-A receptor (BAR) shares significant sequence similarities with other insect allatostatin receptors, yet displays important species-specific characteristics. Sequence comparison reveals that BAR shows 60% amino acid identity with the first Drosophila allatostatin receptor (DAR-1) and 48% identity with the second Drosophila allatostatin receptor (DAR-2) . This substantial similarity indicates evolutionary conservation of receptor structure across diverse insect orders.

The genomic organization of BAR further supports evolutionary relationships with Drosophila receptors. The BAR gene contains two introns positioned at locations that coincide with and share the same intron phasing as two introns in the DAR-1 and DAR-2 genes . This conservation of intron-exon structure provides strong evidence for common evolutionary origins beyond mere sequence similarity.

Functionally, important differences exist in how allatostatin receptors operate across insect orders. While FGL-allatostatins (A-type) strongly inhibit juvenile hormone biosynthesis in cockroaches and crickets, this effect appears to be primarily mediated by C-type allatostatins in lepidopterans like Bombyx mori . This represents a significant functional divergence in neuropeptide signaling systems between insect orders.

In addition to their roles in juvenile hormone regulation, allatostatin receptors serve diverse physiological functions across insect species. In cockroaches, FGL-allatostatins have been shown to inhibit visceral muscle contraction in the hindgut and foregut, while in locusts, they affect egg development by inhibiting vitellogenin production . These diverse functions suggest that allatostatin receptors have evolved specialized roles in different insects while maintaining core signaling capabilities.

What insights can phylogenetic analysis of the Bombyx mori Allatostatin-A receptor provide about neuropeptide receptor evolution?

Phylogenetic analysis of the Bombyx mori Allatostatin-A receptor provides valuable insights into the evolution of neuropeptide signaling systems across the animal kingdom. Modern phylogenetic approaches involving multiple sequence alignments (MSA) using algorithms like MUSCLE, followed by tree construction using Bayesian Inference (BI) and Maximum Likelihood (ML) methods, have helped establish evolutionary relationships between allatostatin receptors and related neuropeptide receptors .

When placed in a broader evolutionary context, allatostatin receptors from insects like Bombyx mori can be compared with related receptors from other arthropods, molluscs, and even deuterostomes . These analyses reveal patterns of receptor diversification and specialization that occurred during animal evolution.

Phylogenetic trees constructed for related receptor families show that the Buccalin-R/AST-AR and AST-C-like/AST-C receptor families form distinct clades within the Rhodopsin γ receptor family . This separation indicates ancient divergence events in receptor evolution, predating the diversification of major animal lineages.

Detailed phylogenetic analysis also enables identification of lineage-specific receptor duplications and losses. In some cases, Bombyx mori and other lepidopterans may possess multiple BAR-related genes, as suggested by Southern blot analysis . These gene duplication events likely facilitated the functional diversification of allatostatin signaling systems, allowing organisms to develop more complex physiological regulation.

Cross-species comparisons further reveal that while core receptor features remain conserved, variable regions have evolved to accommodate species-specific ligand preferences and signaling properties. This evolutionary plasticity likely contributed to the adaptation of allatostatin signaling to the diverse physiological requirements of different insect lineages.

What experimental approaches are most effective for studying ligand-receptor interactions for the Bombyx mori Allatostatin-A receptor?

Studying ligand-receptor interactions for the Bombyx mori Allatostatin-A receptor requires sophisticated experimental approaches that can reveal binding mechanisms and downstream signaling events. Several complementary methodologies have proven particularly effective:

Functional expression systems:
Chinese hamster ovary (CHO) cells permanently transfected with BAR DNA provide an excellent system for studying receptor activation . These cells allow for the assessment of receptor functionality through measurement of second messenger cascades, typically using bioluminescence assays or other readouts of G protein activation.

Pharmacological characterization:
Dose-response experiments using synthetic A-type allatostatins at varying concentrations (typically ranging from 10⁻¹² to 10⁻⁶ M) allow for the determination of EC₅₀ values. This approach has demonstrated that BAR responds to Bombyx A-type allatostatins at concentrations as low as 4 × 10⁻⁹ M .

Structure-activity relationship studies:
Testing receptor activation by allatostatin analogs with modified amino acids can identify the minimal peptide sequences required for receptor activation. This approach is particularly valuable given that Bombyx allatostatin preprohormone contains eight different A-type allatostatins , which may have varying potencies and efficacies at the receptor.

Molecular dynamics simulations:
Computational approaches similar to those used for the C-type allatostatin receptor can be adapted for BAR . These include:

  • Virtual screening to identify potential ligands or modulators

  • Molecular dynamics (MD) simulations to analyze receptor-ligand interactions

  • Molecular mechanics generalized Born surface area (MM/GBSA) calculations to estimate binding free energies

Structural biology approaches:
While challenging for membrane proteins, techniques such as cryo-electron microscopy or X-ray crystallography would provide the most definitive information about receptor-ligand interactions. In the absence of such structures, homology modeling based on related GPCRs can offer valuable insights into the potential three-dimensional organization of the receptor's binding pocket.

How does allatostatin signaling through this receptor impact physiological processes in Bombyx mori?

Allatostatin signaling through the Bombyx mori Allatostatin-A receptor influences several key physiological processes, reflecting the pleiotropic nature of neuropeptide signaling systems. Understanding these impacts requires integrating molecular and physiological approaches:

Juvenile hormone regulation:
While A-type allatostatins strongly inhibit juvenile hormone (JH) biosynthesis in cockroaches, this effect appears to be primarily mediated by C-type allatostatins in lepidopterans like Bombyx mori . Nevertheless, the A-type allatostatin system may still play a modulatory role in JH regulation, potentially acting in concert with other neuropeptides.

Digestive function:
The predominant expression of BAR in the gut suggests a primary role in regulating digestive processes . Allatostatin signaling may modulate gut motility, enzyme secretion, or nutrient absorption. The gut's role in immunity, as seen with proteins like Bm-SP142 and BmTA that have demonstrated antiviral properties against Bombyx mori nuclear polyhedrosis virus (BmNPV) , raises the possibility that allatostatin signaling might also influence gut immune responses.

Developmental coordination:
In related lepidopteran species, allatostatin-related gene expression varies across developmental stages, suggesting stage-specific functions . The signaling system may interact with other hormonal pathways, including those involving ecdysteroids and insulin-like peptides, to coordinate developmental transitions.

Metabolic regulation:
Neuropeptide signaling systems frequently influence metabolic homeostasis. Given the gut expression of BAR, allatostatin signaling may regulate feeding behavior, energy storage, or nutrient utilization. These effects could be particularly important during critical developmental periods or in response to nutritional stress.

Neural signaling:
Although BAR expression is lower in the brain compared to the gut , central nervous system expression suggests roles in neural signaling. Allatostatins may function as neuromodulators, influencing circuits that control feeding, development, or reproductive behaviors.

Understanding these physiological impacts requires experimental approaches ranging from molecular (receptor knockdown/knockout) to organismal (physiological measurements, behavioral assays) levels of analysis.

What strategies can be employed for troubleshooting expression issues with recombinant Bombyx mori Allatostatin-A receptor?

Expressing recombinant G protein-coupled receptors like BAR presents several challenges that researchers must overcome. The following troubleshooting strategies address common expression issues:

For low or undetectable expression:

  • Vector and construct verification: Before extensive troubleshooting, confirm the accuracy of the receptor construct through sequencing and restriction enzyme analysis. Verify that the coding sequence is in-frame with any tags and that start and stop codons are correctly positioned.

  • Expression system optimization: While CHO cells have been successfully used for BAR expression , alternative cell lines (HEK293, COS-7) may provide better expression for specific applications. Compare multiple cell types if expression levels are inadequate.

  • Codon optimization: The codon usage in Bombyx mori differs from mammalian systems. Synthetic gene constructs with codons optimized for the host expression system often yield significantly improved protein expression.

  • Transfection optimization: Systematically optimize transfection parameters including:

    • DNA:transfection reagent ratio (typically testing ratios from 1:1 to 1:5)

    • Cell density at transfection (usually 60-80% confluency is optimal)

    • Transfection duration before analysis (24-72 hours)

    • Media composition during transfection

For non-functional receptor:

  • Ligand validation: Ensure the activity of synthetic allatostatins through mass spectrometry verification and purity analysis. For the eight different A-type allatostatins present in Bombyx , compare their activities to identify the most potent variants for functional assays.

  • Assay system optimization: When using second messenger assays (e.g., bioluminescence measurements as reported for BAR ), optimize assay conditions including:

    • Buffer composition (pH, ionic strength)

    • Incubation times and temperatures

    • Cell density in assay plates

    • Detection instrument settings

  • G protein coupling enhancement: Co-expression of appropriate G protein subunits can enhance functional coupling and signal detection. For BAR, which likely couples to Gi/o proteins, consider co-expressing these specific G protein subtypes.

For protein misfolding or trafficking issues:

  • Expression temperature reduction: Lower the incubation temperature to 28-30°C after transfection to promote proper folding.

  • Addition of chemical chaperones: Compounds like glycerol (5-10%), DMSO (1-2%), or 4-phenylbutyrate can improve folding of membrane proteins.

  • Signal sequence modification: Adding or optimizing signal sequences can improve membrane trafficking of the receptor.

Implementing these strategies systematically while documenting all modifications and results will help overcome expression challenges and produce functional recombinant BAR for research applications.

How can genetic modification techniques be applied to study Bombyx mori Allatostatin-A receptor function in vivo?

Modern genetic modification techniques offer powerful approaches to investigate BAR function in vivo, moving beyond heterologous expression systems to understand the receptor's role in its native context:

CRISPR/Cas9 gene editing approaches:
CRISPR/Cas9 technology enables precise genetic modifications in Bombyx mori that were previously challenging. For BAR research, CRISPR can be employed to:

  • Generate receptor knockout lines to assess loss-of-function phenotypes, particularly focusing on gut development and function given the receptor's predominant expression there .

  • Create knock-in reporter lines by fusing fluorescent proteins to BAR, allowing visualization of receptor expression patterns across tissues and developmental stages.

  • Introduce specific point mutations to study structure-function relationships, particularly in residues predicted to be involved in ligand binding or G protein coupling.

  • Develop conditional knockout systems using inducible promoters to control the timing of receptor inactivation, avoiding potential developmental lethality.

RNA interference strategies:
RNAi approaches provide flexible tools for studying BAR function through targeted knockdown:

  • Systemic RNAi can be achieved through injection of double-stranded RNA targeting BAR, resulting in organism-wide knockdown.

  • Tissue-specific RNAi using appropriate promoters can target BAR expression in specific tissues like the gut or brain to dissect tissue-specific functions.

  • Combinatorial approaches can simultaneously target multiple components of the allatostatin signaling pathway to uncover functional redundancies or synergies.

Transgenic overexpression systems:
Complementing loss-of-function approaches, overexpression studies can reveal gain-of-function phenotypes:

  • Tissue-specific overexpression using the GAL4-UAS system or native tissue-specific promoters can drive BAR expression in tissues where it is not normally expressed.

  • Expression of dominant-negative BAR variants can disrupt normal signaling in specific tissues or developmental stages.

  • Rescue experiments in receptor-null backgrounds can confirm phenotype specificity and test the functionality of modified receptor variants.

These genetic approaches, when combined with physiological and behavioral assays, provide unprecedented opportunities to understand BAR function in the context of the whole organism.

What are promising research avenues involving the Bombyx mori Allatostatin-A receptor for pest management applications?

The Bombyx mori Allatostatin-A receptor represents an intriguing target for developing novel pest management strategies, particularly for lepidopteran agricultural pests. Several promising research avenues include:

Receptor-targeted insecticides:
Understanding the structural and functional properties of BAR opens possibilities for designing selective molecules that specifically target this receptor in pest species. Similar to approaches targeting the C-type allatostatin receptor , virtual screening and molecular dynamics simulations could identify compounds that bind the orthosteric site of BAR. Given that eight different A-type allatostatins are encoded by the Bombyx allatostatin preprohormone , comparative analysis of their binding properties could guide the design of potent synthetic agonists.

Comparative receptor pharmacology:
Research comparing BAR across species could identify conserved features that could be targeted in multiple pest species, as well as divergent features that might enable species-selective targeting. This approach would require cloning and characterizing allatostatin receptors from economically important pest lepidopterans and comparing their pharmacological profiles to the well-characterized Bombyx receptor.

Receptor modulation for growth disruption:
While A-type allatostatins may not be the primary regulators of juvenile hormone in lepidopterans , perturbation of allatostatin signaling could still disrupt critical physiological processes like feeding, gut motility, or metabolism. This avenue would involve examining how receptor activation or inhibition affects growth, development, and reproduction in target pest species.

RNAi-based approaches:
RNA interference targeting the BAR transcript could be delivered through transgenic plants or formulated sprays. This approach requires:

  • Identification of highly conserved regions in pest species' BAR transcripts

  • Development of efficient RNAi delivery systems

  • Assessment of phenotypic effects on pest fitness and survival

Integration with other control strategies:
BAR-targeted approaches could potentially synergize with existing control methods. For example, disruption of gut function through allatostatin receptor modulation might increase susceptibility to Bacillus thuringiensis toxins or baculoviruses, similar to how interfering with peritrophic membrane formation increases susceptibility to baculoviral infection .

These research directions could ultimately lead to more selective and environmentally friendly pest management tools, particularly valuable for controlling lepidopteran pests resistant to conventional insecticides.

What advanced methodologies are emerging for studying signaling dynamics of the Bombyx mori Allatostatin-A receptor?

Emerging advanced methodologies are transforming our ability to study the signaling dynamics of GPCRs like the Bombyx mori Allatostatin-A receptor with unprecedented spatial and temporal resolution:

Biosensor technologies:
New biosensor approaches enable real-time monitoring of receptor activation and downstream signaling events:

  • BRET-based (Bioluminescence Resonance Energy Transfer) biosensors can detect conformational changes in the receptor upon ligand binding, G protein coupling, or β-arrestin recruitment. These sensors can be adapted to BAR by strategic placement of donor and acceptor moieties.

  • FRET-based (Fluorescence Resonance Energy Transfer) sensors can track second messenger production, providing spatiotemporal information about signaling dynamics in living cells.

  • Single-molecule fluorescence microscopy can reveal the formation of signaling complexes and their subcellular localization with nanometer precision.

Advanced computational approaches:
Computational methods are increasingly powerful for predicting and analyzing receptor structure and function:

  • Molecular dynamics simulations similar to those used for AST-C receptor analysis can provide insights into BAR conformational dynamics and ligand interactions. These typically involve running multiple simulation replicates (e.g., 100 ns × 3) and analyzing trajectory frames with tools like the Simulation Interaction Diagram module.

  • Advanced homology modeling using AlphaFold2 or RoseTTAFold can generate increasingly accurate structural predictions even in the absence of experimental structures.

  • Systems biology modeling can integrate receptor signaling into broader physiological networks, predicting whole-organism responses to receptor modulation.

Multi-omics integration:
Comprehensive approaches combining multiple data types can reveal the broader impact of allatostatin signaling:

  • Transcriptomic profiling (RNA-seq) following receptor activation or inhibition can identify downstream gene expression changes.

  • Phosphoproteomics can map signaling cascades activated by receptor stimulation, revealing the complete signaling network.

  • Metabolomics can identify metabolic changes resulting from altered allatostatin signaling, particularly relevant given BAR's gut expression .

In vivo imaging techniques:
Advanced imaging enables visualization of receptor dynamics in living organisms:

  • Tissue clearing methods combined with light-sheet microscopy can visualize receptor expression across entire silkworm tissues or organs.

  • Genetically encoded activity sensors can report receptor activation in real-time in living tissues.

  • Correlated light and electron microscopy can reveal the ultrastructural context of receptor localization.

These emerging methodologies promise to transform our understanding of BAR signaling from static snapshots to dynamic, spatiotemporally resolved models that capture the full complexity of allatostatin signaling in Bombyx mori.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.