Recombinant Bombyx mori Ceropsin (Bcop)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant Bombyx mori Ceropsin (Bcop) is a genetically engineered protein derived from the silkworm (Bombyx mori). Ceropsin is a native protein expressed in B. mori, though its specific biological role remains understudied. The recombinant version is produced via heterologous expression systems, primarily in Escherichia coli (Table 1).

ParameterDetails
Host OrganismE. coli
TagHis-Tag
Protein LengthFull length (1–381 amino acids)
Source SpeciesBombyx mori (silk moth)
Commercial StatusAvailable through biotechnology vendors (e.g., Creative BioMart)

Functional Insights

Ceropsin’s native function in B. mori is unclear, but recombinant Bcop is hypothesized to participate in pathways related to:

  • Immune response: Silkworm proteins often interact with host immunity, though direct evidence for Bcop is lacking.

  • Protein-protein interactions: Potential roles in silk gland biology, given B. mori’s specialized silk production machinery .

Pathways and Interactions
While specific pathway annotations are incomplete, Bcop may interact with:

  • Chaperones: Proteins involved in protein folding (e.g., HSP70).

  • Enzymes: Proteases or glycosidases, though glycosylation patterns in E. coli are minimal .

Production Methods

Bcop is synthesized via heterologous expression in E. coli, leveraging established recombinant protein protocols:

  1. Cloning: Bcop gene is inserted into a plasmid with a His-tag.

  2. Expression: Induced in E. coli (e.g., BL21(DE3)) under optimized conditions.

  3. Purification: Affinity chromatography (Ni-NTA columns) to isolate His-tagged Bcop .

StepDetails
Cloning VectorpET-derived plasmids with T7 promoter
Expression HostE. coli BL21(DE3)
YieldNot reported; inferred to be moderate (mg/L range)

Applications and Research Potential

While Bcop’s specific applications remain unexplored, its production aligns with broader trends in silk protein biotechnology:

  • Biomaterials: Potential use in scaffolds or drug delivery, akin to recombinant sericin or fibroin .

  • Biomedical Research: Utility as a model for studying silkworm protein folding or secretion .

Challenges

  • Limited Functional Data: No peer-reviewed studies on Bcop’s activity or interactions.

  • Comparative Analysis: Direct comparisons with native ceropsin or other silk proteins are absent.

Research Gaps and Future Directions

  1. Mechanistic Studies: Elucidating Bcop’s role in B. mori physiology.

  2. Structural Elucidation: X-ray crystallography or cryo-EM to resolve tertiary structure.

  3. Functional Screens: High-throughput assays to identify binding partners or enzymatic activity.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing. If you require a specific tag, please inform us; we will prioritize its development.
The tag type is determined during the production process. If you have a specific tag requirement, please specify it to ensure preferential development.
Synonyms
Bcop; Ceropsin; Cerebral opsin; Boceropsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
BOMMO(Silk moth)
Target Names
Bcop
Target Protein Sequence
MSISMDAGPGFAALQSWSSQVAAFGNSNQTVVDRVSPEMLHLIDAYWYQFPPMNPLWHAL LGFTIGVLGFISMMGNGMVIYIFMTTKNLKTPSNLLVVNLAFSDFLMMCAMSPAMVINCY NETWVFGPFACELYGCAGSLFGCASIWTMTMIAFDRYNVIVKGIAAKPMTNNGALLRILG IWAFSLAWTVAPFFGWNRYVPEGNMTACGTDYLTKDWFSRSYIVVYSVFVYFAPLLLIVY SYYYIVQAVSAHEKAMREQAKKMNVASLRSSEAANTSTECKLAKVALMTISLWFMAWTPY LVINYTGILESAPISPLATIWGSLFAKANAVYNPIVYGISHPKYQAALYKRFPVLQCHST TTDEASSVASGTTVMEEKPTA
Uniprot No.

Target Background

Function
Visual pigments, the light-absorbing molecules mediating vision, consist of an opsin apoprotein covalently bound to cis-retinal. They may also play a role in photoperiodic photoreception.
Database Links

KEGG: bmor:692426

STRING: 7091.BGIBMGA007787-TA

UniGene: Bmo.696

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed bilaterally in dorsal and ventral anterior protocerebral cells and bilaterally in the dorsal posterior protocerebral and lateral posterior tritocerebral cells (at protein level). Expressed in the larval brain but not in the subesophageal ganglio

Q&A

What is Bombyx mori and why is it valuable for recombinant protein expression?

Bombyx mori is the domesticated silkworm, an economically important insect that synthesizes large amounts of silk proteins in its silk gland to make cocoons. It serves as an excellent bioreactor for recombinant protein production due to several advantages. The silkworm has been extensively studied as a model organism with well-characterized genetics and numerous mutants and genetically improved strains are available . One significant advantage of using Bombyx mori for protein expression is that its host insect is extremely well characterized and methods for mass rearing of B. mori larvae are very well established . Additionally, proteins expressed in insect larvae could undergo a more diverse range of post-translational modifications compared to those produced in cell culture systems .

What are the main expression systems available for recombinant protein production in Bombyx mori?

Based on current research, there are primarily three well-developed expression systems for recombinant protein production in Bombyx mori:

  • Baculovirus Expression Vector Systems (BEVS): Using Bombyx mori Nucleopolyhedrovirus (BmNPV) bacmid systems for transient expression in cultured cells or larvae .

  • Transgenic Silkworm Systems:

    • Transposon-based random insertion (e.g., piggyBac-based transgenesis)

    • Site-specific targeted insertion systems (e.g., TALEN-mediated targeted insertion)

  • Silk Gland-Specific Expression Systems: Utilizing the natural silk protein production machinery, particularly targeting sericin expression loci for fusion protein expression .

How does the BmNPV bacmid system work for recombinant protein expression?

The BmNPV bacmid system (such as bEasyBm described in research) enables rapid generation of recombinant viruses through in vitro transposition without requiring additional purification steps. The system works through the following mechanism:

  • A recombinant BmNPV genome (bacmid) is created that contains bacteriophage lambda site-specific attachment (att) sites for in vitro transposition .

  • The bacmid also contains a toxic barnase gene under the control of a viral early promoter (CpBV ORF3005 promoter), which prevents viral replication in insect cells .

  • During the recombination process, the barnase cassette is replaced with the gene of interest by in vitro transposition using BP Clonase .

  • When the resulting recombinant bacmid DNA is transfected into insect cells, only cells containing the recombinant virus (where toxic barnase is replaced by the gene of interest) can survive and produce the recombinant protein .

  • This system eliminates the need for plaque purification or drug selection steps, as non-recombinant virus replication is blocked by host cell death at an early stage of viral replication .

What advantages does the silk gland offer as a bioreactor for protein production?

The silk gland of Bombyx mori offers several advantages as a bioreactor for recombinant protein production:

  • High Production Capacity: The silk gland naturally produces large amounts of silk proteins (fibroin and sericin), making it an ideal site for high-level recombinant protein expression .

  • Tissue-Specific Expression: The middle silk gland (MSG) specifically expresses sericin proteins at high levels, providing a natural context for fusion protein expression .

  • Secretory Pathway: The silk gland has a well-developed secretory pathway for the efficient production and secretion of proteins into the cocoon shell .

  • Scalability: Methods for mass rearing of B. mori larvae are well established, allowing for large-scale protein production .

  • Protein Yield: Researchers have achieved significant protein yields using silk gland-specific expression. For example, using the Sericin1-EGFP fusion approach, up to 3.1% (w/w) of EGFP protein was produced in the cocoon shell .

How does TALEN-mediated targeted insertion improve protein expression compared to transposon-based systems?

TALEN-mediated targeted insertion represents a significant advancement over transposon-based random insertion methods for several research-critical reasons:

  • Consistent Expression Levels: By targeting specific genomic loci (such as the sericin locus), TALEN-mediated insertion ensures more consistent and predictable expression levels between different transgenic lines, eliminating position effects associated with random insertion .

  • Higher Protein Yields: Research demonstrates that TALEN-mediated targeted insertion can dramatically increase protein yield. For example, human epidermal growth factor (hEGF) production using this approach reached more than 15-fold higher levels than conventional piggyBac-based transgenesis .

  • Genetic Stability: Unlike transposon-based systems which may be prone to gene drift, targeted insertion creates more genetically stable transgenic lines .

  • Precise Fusion Protein Design: The ability to target specific genomic loci allows for precise in-fusion expression systems, such as creating chimeric proteins with silk proteins (e.g., Sericin1-EGFP) that leverage the natural high expression of silk proteins .

  • Reduced Screening Effort: With targeted insertion, the success rate of obtaining transgenic lines with the desired expression characteristics is higher, reducing the screening effort required to identify productive lines .

What factors influence the efficiency of in vitro transposition in BmNPV bacmid systems?

Several critical factors can influence the efficiency of in vitro transposition in BmNPV bacmid systems:

  • Quality of Donor and Acceptor DNA: The purity and concentration of both the bacmid DNA and the donor plasmid containing the gene of interest significantly impact transposition efficiency .

  • Transposase Activity: The activity of the transposase enzyme (like BP Clonase) used for the in vitro transposition reaction must be optimal .

  • Reaction Conditions: Temperature, incubation time, and buffer conditions during the transposition reaction affect the efficiency of the process .

  • Size of the Insert: The size of the gene of interest being inserted can affect transposition efficiency, with larger inserts generally showing lower efficiency .

  • Bacterial Transformation Efficiency: After in vitro transposition, the efficiency of transforming the recombinant bacmid into E. coli affects the recovery of complete recombinant constructs .

  • Selection System: The effectiveness of the selection system (such as blue/white screening) for identifying successful transposition events is crucial .

What experimental methods can be used to verify successful recombinant protein expression in Bombyx mori systems?

Verification of recombinant protein expression in Bombyx mori systems requires multiple complementary approaches:

  • RT-PCR Analysis: To detect viral gene expression (for baculovirus-based systems) or transgene expression. For example, RT-PCR using primer sets specific for essential viral genes like gp64 and vp39 can confirm viral replication .

  • PCR Analysis of Viral DNA: To confirm the presence of the transgene and absence of unwanted sequences in viral DNA extracted from infected cells. This approach can verify the replacement of selection markers or toxic genes with the gene of interest .

  • Fluorescence Microscopy: For fluorescent reporter proteins like EGFP, direct visualization of expression in tissues or cells provides immediate confirmation of expression .

  • Protein Extraction and Quantification: Methods such as Bradford assay can be used to quantify total protein content, followed by specific quantification of the recombinant protein .

  • Western Blot Analysis: For specific detection and semi-quantitative analysis of the recombinant protein using antibodies against the target protein or against protein tags .

  • Functional Assays: For proteins with measurable biological activities, functional assays provide the most relevant confirmation of successful expression of active protein .

What are the main challenges in scaling up recombinant protein production using the Bombyx mori silk gland?

Despite the many advantages, scaling up recombinant protein production in the Bombyx mori silk gland faces several challenges:

  • Genetic Stability: Maintaining genetic stability over multiple generations of transgenic silkworms can be challenging, particularly with transposon-based systems prone to gene drift .

  • Protein Extraction and Purification: Developing efficient methods for extracting and purifying the recombinant protein from the silk gland or cocoon shell while maintaining its biological activity remains challenging .

  • Post-translational Modifications: While diverse post-translational modifications are possible in the silk gland, ensuring that these modifications match those required for protein function (especially for therapeutic proteins) requires careful characterization .

  • Expression Consistency: Ensuring consistent expression levels between individual silkworms and between generations requires robust transgenic lines and careful breeding protocols .

  • Regulatory Considerations: For production of therapeutic proteins, meeting regulatory requirements for production in an insect system presents additional challenges compared to established mammalian cell culture platforms.

How should researchers select between different Bombyx mori expression systems for a specific recombinant protein?

The selection of an appropriate expression system depends on several factors:

FactorBmNPV Bacmid SystemTransgenic Silk Gland (TALEN)Transgenic Silk Gland (Transposon)
Time to ExpressionDays (transient)Months (stable line creation)Months (stable line creation)
Expression LevelModerate to highVery high (up to 15× higher than transposon)Moderate
Scale-up PotentialLimited by infection efficiencyExcellent (breeding)Good (breeding)
Protein SizeGood for various sizesBest for small to medium proteinsLimited by position effects
Post-translational ModificationsCell-dependentComplex larval modificationsComplex larval modifications
Genetic StabilityN/A (transient)HighVariable
Technical ComplexityModerateHigh (requires TALEN expertise)Moderate

Researchers should consider:

  • Required expression timeframe

  • Needed quantity of protein

  • Requirements for post-translational modifications

  • Available technical expertise and resources

  • Long-term vs. short-term production needs

What strategies can improve the yield of difficult-to-express recombinant proteins in Bombyx mori?

For challenging proteins, several optimization strategies can be employed:

  • Codon Optimization: Adapting the coding sequence to Bombyx mori codon usage preferences can significantly improve expression levels.

  • Fusion Protein Approaches: Creating fusion proteins with well-expressed silk proteins (like Sericin1) can dramatically increase expression, as demonstrated with the Sericin1-EGFP fusion that reached 3.1% (w/w) of the cocoon shell .

  • Promoter Selection: Choosing appropriate promoters for the expression system. For baculovirus systems, polyhedrin or p10 promoters provide high-level late expression, while for transgenic approaches, the natural sericin promoter drives high-level expression in the middle silk gland .

  • Signal Peptide Optimization: Using silk protein signal peptides can improve secretion efficiency for proteins intended for secretion into the silk gland lumen or cocoon shell .

  • Expression Timing: For baculovirus systems, optimizing the timing of protein harvest based on the characteristics of the protein can maximize yield and reduce degradation .

  • Prevention of Proteolysis: Addition of protease inhibitors or co-expression of protease inhibitors can reduce degradation of sensitive proteins .

How can researchers characterize and validate post-translational modifications in proteins expressed in Bombyx mori?

Post-translational modifications (PTMs) in recombinant proteins expressed in Bombyx mori require thorough characterization:

  • Mass Spectrometry (MS): Techniques such as MALDI-TOF MS or LC-MS/MS can identify specific PTMs and their locations within the protein sequence.

  • Glycan Analysis: For glycosylated proteins, techniques such as lectin affinity chromatography, PNGase F treatment followed by MS analysis, or monosaccharide composition analysis can characterize glycan structures.

  • Enzymatic Deglycosylation: Treatment with specific glycosidases followed by gel mobility shift analysis can provide information about the presence and type of glycosylation.

  • Phosphorylation Analysis: Western blotting with phospho-specific antibodies or phosphoprotein-specific staining can detect phosphorylation, while MS can identify specific phosphorylation sites.

  • Functional Assays: Comparing the activity of the recombinant protein with standards produced in other systems can reveal the impact of PTMs on function.

  • Comparative Analysis: Comparing PTMs of proteins produced in different B. mori tissues (silk gland vs. hemolymph) or developmental stages can provide insights into tissue-specific modification patterns .

What genomic resources are available to support recombinant protein expression research in Bombyx mori?

Researchers working with Bombyx mori have access to extensive genomic resources:

  • EST Database (SilkBase): Contains approximately 35,000 ESTs from 36 cDNA libraries, grouped into approximately 11,000 non-redundant ESTs with an average length of 1.25 kb. This database covers more than 55% of all genes of Bombyx mori .

  • Molecular Linkage Maps: Approximately 1,500 markers based on various techniques are available, covering all 28 Bombyx chromosomes at an average spacing of 2 cM (equivalent to approximately 500 kb) .

  • Tissue-Specific Expression Data: The EST database includes data from numerous tissues and developmental stages, allowing researchers to identify promoters with tissue-specific expression patterns .

  • Comparative Genomic Resources: Direct links between SilkBase and databases like FlyBase and WormBase facilitate comparative genomic analyses and identification of gene functions based on homology .

  • Specialized Libraries: Various cDNA libraries from different developmental stages and tissues (including brain, embryo, fat body, hemocyte, silk gland, testis, wing disk) provide valuable resources for identifying stage-specific and tissue-specific genes .

What novel approaches are being developed to enhance site-specific integration in Bombyx mori?

While TALEN-mediated targeted insertion has been successfully used in Bombyx mori, several cutting-edge approaches are being explored:

  • CRISPR/Cas9 Systems: Although the search results indicate that TALEN has been more successful in B. mori than other engineered nucleases, ongoing research is focusing on optimizing CRISPR/Cas9 systems for the silkworm .

  • Improved Homology-Directed Repair (HDR): Enhancing HDR efficiency through the use of various DNA repair pathway modulators could improve targeted integration rates.

  • Combination Approaches: Using multiple genome editing tools in combination (e.g., TALEN with donor templates optimized for silkworm genomic context) may further improve targeting efficiency.

  • Tissue-Specific Genome Editing: Developing methods for tissue-specific expression of genome editing tools to target modifications to specific tissues like the silk gland.

  • Alternative Target Sites: While the sericin locus has proven successful, identifying and validating additional genomic safe harbor sites in the B. mori genome could expand the toolkit for recombinant protein expression .

How does Bombyx mori compare to other insect expression systems for complex recombinant proteins?

Bombyx mori offers several distinct advantages and limitations compared to other insect expression systems:

FeatureBombyx moriSf9/Sf21 (Spodoptera frugiperda)High Five (Trichoplusia ni)
Scale-up PotentialHigh (whole organism)Limited by bioreactor sizeLimited by bioreactor size
Protein YieldVery high in silk glandModerate to highHigh
Post-translational ModificationsComplex, larval-typeLess complex, cell-typeLess complex, cell-type
System ComplexityHigh (insect rearing)Moderate (cell culture)Moderate (cell culture)
Time to ProductionLonger (for transgenic)ShorterShorter
Genomic ResourcesExtensiveLimitedLimited
Established ProtocolsWell-established for silk proteinsWell-established for various proteinsWell-established for various proteins

Bombyx mori is particularly advantageous for:

  • Large-scale production of proteins that benefit from complex post-translational modifications

  • Proteins that can be functionally expressed as fusions with silk proteins

  • Situations where the economics of scalable insect rearing outweigh the convenience of cell culture

How can researchers address low expression levels in Bombyx mori expression systems?

When facing low expression levels, several methodological approaches can be applied:

  • Verify Construct Integrity: Confirm that the expression construct contains the correct sequence and regulatory elements through sequencing and restriction analysis.

  • Optimize Codon Usage: Analyze and adjust the codon usage of the gene of interest to match Bombyx mori preferences.

  • Check for Toxicity: If the protein is toxic to the insect cells or larvae, consider using inducible promoters or targeting expression to specific tissues that might better tolerate the protein.

  • Evaluate Protein Stability: Add protease inhibitors during extraction or co-express protease inhibitors to prevent degradation of sensitive proteins.

  • Improve Extraction Methods: Optimize protein extraction conditions (buffers, temperature, time) to ensure efficient recovery of the expressed protein.

  • Modify the Expression System: For baculovirus systems with low expression, consider switching to a transgenic approach targeting the sericin locus, which has shown up to 15-fold higher expression for some proteins .

  • Add Fusion Partners: Consider adding solubility-enhancing fusion partners or utilizing the sericin fusion approach that has demonstrated high expression levels .

What factors should be considered when designing experiments to compare different Bombyx mori expression systems?

When designing comparative studies of expression systems, researchers should consider:

  • Standardized Reporting Metrics: Use consistent metrics for protein quantification, such as percentage of total protein or yield per gram of tissue or per insect.

  • Control Variables: Maintain consistent environmental conditions (temperature, humidity, diet) for silkworm rearing to eliminate variables that might affect protein expression.

  • Temporal Considerations: Compare protein expression at equivalent developmental stages when using different systems.

  • Protein Functionality: Assess not only the quantity but also the quality and activity of the expressed protein using appropriate functional assays.

  • Extraction Efficiency: Use identical extraction and purification protocols when comparing different systems to ensure that differences in yield are not due to differences in extraction efficiency.

  • Statistical Power: Include sufficient biological replicates (different individual silkworms or independent cell cultures) to ensure statistical significance of the observed differences.

  • Cost and Time Analysis: Document all resources used (time, materials, labor) to provide a comprehensive comparison of the efficiency of different systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.