Recombinant Borago officinalis Cytochrome b5

Shipped with Ice Packs
In Stock

Description

Introduction

Borago officinalis, commonly known as borage, is a plant species that has garnered scientific interest due to its unique fatty acid composition and other potentially beneficial compounds . Within B. officinalis, the enzyme Δ6-fatty acid desaturase is notable for containing an N-terminal extension homologous to cytochrome b5 (Cyt b5) . Recombinant Borago officinalis Cytochrome b5 refers to the Cyt b5 domain of this enzyme, produced using recombinant DNA technology . This recombinant protein has been studied to elucidate its role in fatty acid desaturation and its potential applications .

Production and Purification

Recombinant Borago officinalis Cytochrome b5 can be produced in Escherichia coli (E. coli) to facilitate its characterization . The typical process involves:

  1. Cloning the gene sequence encoding the Cyt b5 domain into an expression vector.

  2. Transforming E. coli cells with the expression vector.

  3. Inducing protein expression using a suitable inducer, such as IPTG.

  4. Lysing the E. coli cells and purifying the recombinant protein using affinity chromatography or other suitable methods.

  5. Verifying the purity of the protein using SDS-PAGE, with a typical purity level exceeding 85% .

Role in Fatty Acid Desaturation

The primary function of the Cyt b5 domain in the Borago officinalis Δ6-desaturase is to facilitate the desaturation of fatty acids . The Δ6-desaturase is responsible for converting linoleic acid (18:2 ω-6) to γ-linolenic acid (GLA, 18:3 ω-6) and α-linolenic acid (18:3 ω-3) to octadecatetraenoic acid (OTA, 18:4 ω-3) . The Cyt b5 domain plays a crucial role in this process by:

  • Electron Transfer: Acting as an electron donor, providing the electrons necessary for the desaturation reaction .

  • Enzyme Activity: Ensuring the proper function of the Δ6-desaturase, as demonstrated by the loss of activity upon its deletion or mutation .

Biochemical Assays and Analysis

Several biochemical assays and analytical techniques are employed to study Recombinant Borago officinalis Cytochrome b5:

  • Spectroscopy: Redox absorbance spectra are used to confirm the heme-binding nature and redox properties of the recombinant protein .

  • Site-Directed Mutagenesis: Mutating key residues, such as Histidine-41, to assess their impact on enzyme activity .

  • Expression Studies: Expressing the Cyt b5 domain in transgenic plants, such as Arabidopsis, to observe the effects on fatty acid composition .

  • Fatty Acid Analysis: Analyzing the fatty acid content of transgenic plants using gas chromatography to quantify the production of Δ6-unsaturated fatty acids .

Potential Applications

The study of Recombinant Borago officinalis Cytochrome b5 and the Δ6-desaturase has potential applications in:

  • Nutritional Enhancement: Modifying the fatty acid composition of crops to enhance their nutritional value .

  • Biotechnology: Producing specific unsaturated fatty acids for industrial or pharmaceutical purposes .

  • Plant Breeding: Developing new varieties of plants with improved oil profiles .

Data Table

PropertyDescription
Protein NameCytochrome b5, partial
SourceE. coli
Purity>85% (SDS-PAGE)
Molecular WeightApproximately 12 kDa
Heme BindingBinds heme, essential for electron transfer
Redox ActivityExhibits redox absorbance spectra similar to plant microsomal Cyt b5
Key ResiduesHistidine-41 (axial heme-binding residue)
FunctionElectron donor for Δ6-fatty acid desaturase
ApplicationsNutritional enhancement, biotechnology, plant breeding

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment of your specific requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its incorporation.
Synonyms
Cytochrome b5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Borago officinalis (Bourrache) (Borage)
Target Protein Sequence
MGKIFTLAEVAQHNNSKDCWLIINGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFEDIG HSSSAKAMLDEYYVGDIDSSSIPSQVKYTPPKQPLYNPDKTREFVIKLLQFLVPLVILAG AIGIRFYTKSSA
Uniprot No.

Target Background

Function
Membrane-bound hemoprotein functioning as an electron carrier for various membrane-bound oxygenases.
Protein Families
Cytochrome b5 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side.

Q&A

What is cytochrome b5 and what is its role in Borago officinalis?

Cytochrome b5 is a small heme-binding protein that functions as an electron donor delivering reducing power to terminal enzymes involved in oxidative reactions . In Borago officinalis (borage), cytochrome b5 is characterized by the presence of an N-terminal cytochrome b5 domain that plays crucial roles in multiple metabolic pathways . This protein is particularly important in fatty acid metabolism, including the desaturation pathways that lead to the production of gamma-linolenic acid (GLA), one of the medicinal components for which borage is known .

Borage cytochrome b5 is implicated in the biosynthesis of specialized fatty acids and membrane lipids, where it shuttles reducing equivalents from NADH to terminal acceptors, usually ER-localized non-heme, iron-containing enzymes involved in fatty acid modification . The protein shows high similarity to plant Δ8-sphingolipid desaturases and Δ6-fatty acyl desaturase, indicating its importance in lipid metabolism pathways specific to Borago officinalis .

How does the structure of Borago officinalis cytochrome b5 compare to other plant cytochrome b5 proteins?

Unlike mammals and yeast which typically have a single copy of the CB5 gene, higher plants have evolved multiple copies of this gene, suggesting more diverse and specialized functions in the plant kingdom . Borago officinalis cytochrome b5 contains a characteristic N-terminal cytochrome b5 domain that defines its electron transfer capabilities .

The sequence characterization reveals that Borago officinalis cytochrome b5 shares structural similarities with other plant cytochrome b5 proteins while maintaining species-specific variations. Like other plant CB5 proteins, it likely contains a conserved heme-binding domain and a hydrophobic membrane-anchoring domain at the C-terminus. The presence of the N-terminal cytochrome b5 domain in Borago officinalis is particularly important for its function in desaturation and hydroxylation reactions in lipid metabolism .

While the search results don't provide specific spectral data for Borago officinalis cytochrome b5, information from other plant cytochrome b5 proteins suggests the following characteristic spectral features for properly folded, heme-containing recombinant cytochrome b5:

Properly expressed plant cytochrome b5 in E. coli exhibits oxidized, reduced, and low-temperature absorbance spectra characteristic of plant microsomal cytochrome b5, along with a circular dichroism (CD) spectrum resembling that of mammalian cytochrome b5 . These spectral characteristics serve as important quality control indicators during purification and functional characterization of recombinant cytochrome b5 proteins.

The visual appearance of transformed E. coli cells expressing cytochrome b5 (red coloration) provides a convenient preliminary indicator of successful expression with proper heme incorporation . This characteristic can be used as a quick assessment tool during expression optimization.

How does the N-terminal cytochrome b5 domain in Borago officinalis affect its function in fatty acid desaturation?

The N-terminal cytochrome b5 domain is crucial for the function of Borago officinalis cytochrome b5 in fatty acid desaturation pathways. This domain characterizes the sequence of proteins involved in desaturation processes and enables the protein to function as an electron shuttle intermediate .

In plants, cytochrome b5 serves as an electron carrier, delivering reducing equivalents from pyridine nucleotide cofactors to terminal enzymes involved in fatty acid desaturation, hydroxylation, and triple bond formation . The N-terminal domain allows the protein to transfer electrons from NADH through cytochrome b5 reductase (CBR) to terminal enzymes independently of NADPH-cytochrome P450 reductase (CPR), or to transfer the second electron to oxyferrous P450 from CPR .

This electron transfer capability is essential for the desaturation reactions that introduce double bonds into fatty acids, such as the formation of gamma-linolenic acid, which is abundant in Borago officinalis seed oil. The domain likely also mediates specific protein-protein interactions with desaturases and other enzymes in the fatty acid modification pathway.

What are the electron transfer mechanisms of Borago officinalis cytochrome b5 in reconstituted systems?

Plant cytochrome b5 proteins, including those from Borago officinalis, can participate in electron transfer through multiple pathways in reconstituted systems:

  • As an electron shuttle intermediate, cytochrome b5 can transfer two electrons from NADH through cytochrome b5 reductase (CBR) to terminal enzymes, independent of NADPH-cytochrome P450 reductase (CPR) .

  • Alternatively, it can transfer the second electron to oxyferrous P450 from CPR, completing the electron transfer chain required for P450-catalyzed reactions .

  • Plant cytochrome b5 proteins can be reduced by both CBR and CPR, but these reductases display strict specificity toward their respective pyridine nucleotide cofactors. CBR specifically utilizes NADH to reduce cytochrome b5, while CPR shows specificity for NADPH .

The efficiency of these electron transfer pathways can vary depending on the specific terminal enzyme involved, the experimental conditions, and the presence of other cellular components. In Arabidopsis, disrupting the ER-localized CBR resulted in no significant impairment on mature stem lignin biosynthesis, while disrupting CPR2 suppressed both G- and S-lignin synthesis up to 50%, suggesting that some plant cytochrome b5 proteins primarily couple with the NADPH-CPR electron transport pathway for certain metabolic processes .

How does recombinant Borago officinalis cytochrome b5 interact with different P450 enzymes?

While specific interactions between Borago officinalis cytochrome b5 and P450 enzymes aren't detailed in the search results, insights from other plant cytochrome b5 interactions suggest complex and specific relationships:

Plant cytochrome b5 proteins can physically interact with various P450 enzymes, but these interactions display functional specificity. For example, Arabidopsis cytochrome b5-D (AtCB5-D) physically interacts with multiple monolignol biosynthetic P450 enzymes as demonstrated by yeast two-hybrid (Y2H) and bimolecular fluorescence complementation (BiFC) assays, but functionally only associates with ferulate 5-hydroxylase (F5H1) specific for the synthesis of S-lignin monomer and related 5-hydroxylated phenolics .

This suggests that physical interaction doesn't necessarily translate to functional cooperation, and there may be additional determinants of specificity beyond physical binding. For Borago officinalis cytochrome b5, we might expect specific functional interactions with P450 enzymes involved in fatty acid modification and sphingolipid metabolism, which are important metabolic pathways in this plant species.

What challenges arise when expressing functionally active Borago officinalis cytochrome b5 in heterologous systems?

Several challenges may arise when expressing functionally active plant cytochrome b5 in heterologous systems:

  • Heme incorporation: Proper incorporation of the heme prosthetic group is essential for cytochrome b5 function. Inhibition of heme synthesis by gabaculin or succinylacetone prevents the assembly of cytochrome b5 holoprotein but has little effect on the accumulation of cytochrome apoprotein . This indicates that heme availability and incorporation can be limiting factors in heterologous expression.

  • Membrane integration: As cytochrome b5 is typically a membrane-anchored protein, proper integration into the membrane might be challenging in heterologous systems with different membrane compositions.

  • Redox partner compatibility: For functional studies, the recombinant cytochrome b5 needs to interact with appropriate redox partners (like cytochrome b5 reductase or P450s). The compatibility of Borago officinalis cytochrome b5 with redox partners from heterologous systems may vary.

  • Post-translational modifications: Any plant-specific post-translational modifications required for Borago officinalis cytochrome b5 function might be absent or different in heterologous systems.

  • Protein folding and stability: The heterologous environment might affect protein folding and stability, potentially leading to aggregate formation or degradation.

Understanding and addressing these challenges is crucial for successful expression and functional characterization of recombinant Borago officinalis cytochrome b5.

How can site-directed mutagenesis be used to investigate the structure-function relationship of Borago officinalis cytochrome b5?

Site-directed mutagenesis offers powerful approaches to investigate structure-function relationships in Borago officinalis cytochrome b5:

  • Heme-binding domain analysis: Mutating conserved histidine residues in the heme-binding pocket would allow assessment of their contribution to heme coordination, redox potential, and electron transfer capability.

  • Membrane anchoring studies: Targeted mutations in the hydrophobic C-terminal membrane-anchoring domain could reveal how membrane association affects protein function, particularly in relation to interactions with membrane-bound redox partners.

  • N-terminal domain investigation: Since Borago officinalis cytochrome b5 is characterized by an N-terminal cytochrome b5 domain , systematic mutagenesis of this region could elucidate its role in electron transfer, substrate recognition, and interactions with specific desaturases.

  • Interface mapping: By mutating residues at potential protein-protein interaction interfaces, researchers could identify key determinants of specificity in the interaction of Borago officinalis cytochrome b5 with different redox partners, particularly those involved in fatty acid desaturation pathways.

  • Redox potential modulation: Mutations affecting the environment of the heme group could alter the redox potential of the protein, potentially changing its electron transfer properties and allowing investigation of the relationship between redox potential and functional specificity.

Each mutant would need comprehensive characterization in terms of structural integrity, heme incorporation, spectral properties, redox potential, and functional activity to establish meaningful structure-function relationships.

What methods can determine differences in redox potential between recombinant and native Borago officinalis cytochrome b5?

Several factors might contribute to redox potential differences between recombinant and native Borago officinalis cytochrome b5, including variations in protein folding, heme incorporation, post-translational modifications, and the membrane environment. To accurately determine these differences, several complementary methods can be employed:

  • Spectroelectrochemical titration: This technique combines spectroscopy with electrochemistry to monitor the redox state of the heme group while applying controlled potentials, allowing precise determination of the midpoint redox potential.

  • Cyclic voltammetry: This electrochemical method can directly measure electron transfer reactions at electrode surfaces, providing information on redox potentials and electron transfer kinetics.

  • Potentiometric titration: By using redox mediators with known potentials and spectroscopically monitoring the oxidation state of cytochrome b5, researchers can determine the protein's redox potential.

  • Differential pulse voltammetry: This sensitive electrochemical technique can detect small differences in redox potentials between native and recombinant forms of the protein.

  • Comparative functional assays: Measuring the rates of electron transfer to specific acceptor proteins or molecules at different applied potentials can provide functional correlates to the measured redox potentials.

These methods, applied to both native and recombinant forms under identical conditions, would provide comprehensive insights into how expression systems and purification methods might affect the fundamental redox properties of Borago officinalis cytochrome b5.

What is the optimal protocol for purifying recombinant Borago officinalis cytochrome b5 from E. coli?

Based on successful approaches for plant cytochrome b5 proteins, an optimized protocol for purifying recombinant Borago officinalis cytochrome b5 from E. coli would include:

  • Expression system selection: Utilize a T7 polymerase/promoter system in E. coli, which has been shown to yield high levels of cytochrome b5 expression (approximately 30% of total cell protein) .

  • Culture conditions: Successfully transformed cells expressing cytochrome b5 should appear visibly red in color due to heme incorporation, providing a convenient visual indicator of expression success .

  • Cell harvesting and lysis: Collect cells by centrifugation and disrupt them using sonication or mechanical methods in an appropriate buffer system that maintains protein stability.

  • Membrane fraction isolation: Perform differential centrifugation to separate membrane fractions containing the membrane-anchored cytochrome b5.

  • Protein solubilization: Use mild detergents to solubilize the membrane-bound cytochrome b5 while preserving its native structure and heme incorporation.

  • Chromatographic purification: Employ a combination of ion exchange chromatography, potentially followed by affinity chromatography (if a tag is incorporated) and/or size exclusion chromatography.

  • Quality control: Verify purity by SDS-PAGE and confirm proper folding and heme incorporation through spectral analysis of both oxidized and reduced forms .

  • Functional verification: The purified cytochrome b5 should be reducible by NADH in the presence of appropriate microsomal preparations containing cytochrome b5 reductase .

This protocol should be optimized for specific parameters including expression temperature, induction timing, detergent selection, and buffer composition to maximize yield and preserve the functional integrity of Borago officinalis cytochrome b5.

How can heme incorporation be optimized when expressing Borago officinalis cytochrome b5 in bacterial systems?

Heme incorporation is critical for functional cytochrome b5 expression. Several strategies can be employed to optimize this process:

  • Supplementation with heme precursors: Adding δ-aminolevulinic acid (ALA), a precursor in heme biosynthesis, to the culture medium can enhance endogenous heme production in E. coli.

  • Heme addition: Directly supplementing the growth medium with hemin (the oxidized form of heme) can provide an exogenous source of the prosthetic group.

  • Expression temperature modulation: Lower temperatures (15-25°C) can slow protein synthesis, allowing more time for proper folding and heme incorporation.

  • Induction optimization: Using lower concentrations of inducers and longer expression times can improve the ratio of holoprotein (heme-containing) to apoprotein (heme-free).

  • Coexpression strategies: Coexpressing genes involved in heme biosynthesis could increase the intracellular availability of heme for incorporation into cytochrome b5.

  • Avoiding heme synthesis inhibitors: Ensuring that no inhibitors of heme synthesis like gabaculin or succinylacetone are present in the growth medium is essential, as these prevent the assembly of cytochrome b5 holoprotein .

  • Host strain selection: Some E. coli strains may have more efficient heme biosynthesis pathways or better heme uptake capabilities, making them more suitable for cytochrome b5 expression.

Monitoring the color of the bacterial culture (which should be reddish if heme incorporation is successful) and performing spectral analysis of the expressed protein can provide feedback on the effectiveness of these optimization strategies.

What assays can be used to measure the electron transfer activity of recombinant Borago officinalis cytochrome b5?

Multiple complementary assays can be employed to measure the electron transfer activity of recombinant cytochrome b5:

For Borago officinalis cytochrome b5, reconstituted enzyme assays with specific desaturases involved in gamma-linolenic acid synthesis would be particularly relevant for assessing functional activity in its native metabolic context. The recombinant protein should be biologically active, being reduced by NADH in the presence of appropriate microsomal membranes, as demonstrated for other plant cytochrome b5 proteins .

How can the interaction between Borago officinalis cytochrome b5 and its redox partners be characterized?

Several complementary approaches can be used to characterize the interaction between Borago officinalis cytochrome b5 and its redox partners:

  • Yeast two-hybrid (Y2H) assays: This technique can detect physical interactions between cytochrome b5 and potential redox partners like P450 enzymes, as demonstrated for other plant cytochrome b5 proteins .

  • Bimolecular fluorescence complementation (BiFC): This approach allows visualization of protein-protein interactions in living cells, providing spatial information about where interactions occur within cellular compartments .

  • Surface plasmon resonance (SPR): This technique provides quantitative measurements of binding affinities and kinetics between purified proteins, offering insights into the strength and dynamics of interactions.

  • Co-immunoprecipitation (Co-IP): Using antibodies specific to cytochrome b5 or its potential partners to pull down protein complexes can identify interacting proteins in more native conditions.

  • Functional coupling assays: Measuring substrate conversion rates by terminal enzymes in the presence of cytochrome b5 and various potential redox partners can establish functional relevance of interactions.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry can identify specific interaction interfaces between cytochrome b5 and its partners at the amino acid level.

It's important to note that physical interaction doesn't always indicate functional coupling. As illustrated with Arabidopsis cytochrome b5-D, a protein can physically interact with multiple P450 enzymes but functionally associate with only specific ones . Therefore, combining physical interaction studies with functional assays is necessary to fully characterize the biologically relevant interactions of Borago officinalis cytochrome b5 with its redox partners.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.