Recombinant Bordetella avium ATP synthase subunit a (atpB)

What is Bordetella avium ATP synthase subunit a (atpB) and what is its biological function?

Bordetella avium ATP synthase subunit a (atpB) is a critical component of the F0 sector of ATP synthase in Bordetella avium bacteria. This membrane protein functions as part of the proton channel that drives ATP synthesis through the chemiosmotic mechanism. The protein consists of 293 amino acids and plays an essential role in proton transport across the membrane, which generates the electrochemical gradient necessary for ATP production .

ATP synthase operates through a chemiosmotic mechanism where protons move down a concentration gradient, driving the synthesis of ATP. This was confirmed through experiments with broken chloroplasts, demonstrating that a proton gradient across membranes is sufficient to drive ATP synthesis even without light . In the context of Bordetella avium, the atpB subunit forms part of the membrane-embedded channel that facilitates this proton movement.

What are the structural characteristics of Recombinant Bordetella avium ATP synthase subunit a (atpB)?

Recombinant Bordetella avium ATP synthase subunit a (atpB) from strain 197N corresponds to UniProt accession Q2KU30. The full amino acid sequence begins with MAAASGASPQSEYIQHHLVHLNNLGEKQSVIAQFNVINYDSLFWSGLMGLIVIFCLWLAA and continues through the entire 293-amino acid sequence . The protein contains multiple transmembrane domains characteristic of F0 sector components, with hydrophobic regions that anchor the protein within the membrane bilayer.

The protein's structure features regions critical for proton conductance and interaction with other ATP synthase subunits. Structural studies indicate that atpB contains highly conserved residues that participate directly in proton translocation, particularly those forming the proton channel through the membrane.

How is Recombinant Bordetella avium ATP synthase subunit a (atpB) typically expressed and purified for research?

Recombinant Bordetella avium ATP synthase subunit a (atpB) is generally expressed using bacterial expression systems, most commonly E. coli strains optimized for membrane protein expression. The methodology involves:

• Cloning the atpB gene (BAV3220) from Bordetella avium strain 197N into an appropriate expression vector

• Transforming the construct into an expression host

• Inducing protein expression under optimized conditions

• Membrane isolation and solubilization using detergents

• Purification via affinity chromatography using tags determined during the production process

For research applications, the purified protein is stored in Tris-based buffer with 50% glycerol at -20°C, with extended storage recommended at -80°C to maintain stability . Repeated freeze-thaw cycles should be avoided, with working aliquots kept at 4°C for up to one week.

What detection methods are available for studying Recombinant Bordetella avium ATP synthase subunit a (atpB)?

Several validated detection methods can be employed for studying this protein:

Recombinant antibodies specifically targeting ATP synthase subunits have been validated for these applications, including ELISA assays that can detect the protein in complex samples . These methods allow researchers to track expression, localization, and interactions of the atpB protein in experimental systems.

How can researchers verify the functional activity of purified Recombinant Bordetella avium ATP synthase subunit a (atpB)?

Verifying functional activity of recombinant atpB requires assessing its ability to participate in proton translocation and ATP synthesis when incorporated into membrane systems. Methodological approaches include:

• Reconstitution assays: Incorporate purified atpB into proteoliposomes with other ATP synthase subunits, then measure ATP synthesis driven by artificially created proton gradients. This approach mirrors experiments where investigators created artificial vesicles with light-driven proton pumps (such as bacteriorhodopsin) to demonstrate ATP synthase activity .

• Proton flux measurements: Using pH-sensitive fluorescent dyes to track proton movement across membranes containing reconstituted atpB.

• Complementation studies: Express recombinant atpB in bacterial strains with atpB deletions to assess functional rescue.

• Patch-clamp electrophysiology: Measure proton conductance through channels containing atpB in artificial membrane systems.

Successful verification would demonstrate that the recombinant protein maintains its native conformation and can participate in the chemiosmotic coupling mechanism that drives ATP synthesis.

What are the challenges in expressing and purifying functional Recombinant Bordetella avium ATP synthase subunit a (atpB)?

Producing functional recombinant atpB presents several significant challenges:

• Membrane protein expression barriers: As a hydrophobic membrane protein, atpB often forms inclusion bodies or causes toxicity to expression hosts.

• Proper folding concerns: Maintaining the native conformation during extraction from membranes is difficult, as detergents may disrupt crucial structural elements.

• Stability issues: The protein may show reduced stability when removed from its native membrane environment, requiring careful optimization of buffer conditions .

• Functional assessment complexity: Verifying functional activity requires reconstitution with other ATP synthase components, representing a significant technical challenge.

• Protein-lipid interactions: The specific lipid environment may be crucial for proper function, necessitating careful consideration of reconstitution conditions.

To address these challenges, researchers typically optimize expression conditions (temperature, inducer concentration, host strain), explore various detergents for solubilization, and test different buffer compositions to maintain stability during purification and storage .

How can computational approaches predict ATP binding sites in Bordetella avium ATP synthase subunit a (atpB)?

Computational approaches for predicting ATP binding sites have advanced significantly, with tools like ATPbind providing accurate predictions by combining sequence and structural information. The methodology involves:

• Sequence-based features: Analysis of evolutionary conservation, physicochemical properties, and binding propensity of amino acid residues.

• Structure-based features: Examination of pocket geometry, electrostatic potential, and solvent accessibility when structural data is available.

• Machine learning integration: Support Vector Machines (SVMs) combining multiple features to identify binding sites with high accuracy.

Current approaches like ATPbind can achieve approximately 72% prediction accuracy, covering 62% of ATP binding sites while maintaining a high Matthews correlation coefficient compared to other predictors . These approaches are particularly valuable for identifying potential binding sites in proteins like atpB where experimental determination may be challenging.

For Bordetella avium ATP synthase subunit a, binding site prediction would focus on regions interacting with other ATP synthase components rather than direct ATP binding, as the catalytic sites are primarily located in the F1 sector of the complex.

What phylogenetic insights can be gained from studying the atpB gene sequences across bacterial species?

The atpB gene provides valuable phylogenetic information, as demonstrated in studies of chloroplast atpB sequences in plant systematics. Key methodological considerations include:

• Sequence alignment: Multiple sequence alignment of atpB genes from diverse bacterial species, including Bordetella and related taxa.

• Phylogenetic signal assessment: Statistical evaluation of phylogenetic signal strength within the aligned sequences.

• Tree construction: Maximum parsimony, maximum likelihood, or Bayesian inference methods to construct phylogenetic trees.

• Combined analysis: Integration of atpB data with other gene sequences (similar to combined atpB and rbcL analyses in plant studies) for improved phylogenetic resolution .

Studies have shown that atpB contains significant phylogenetic signal and can contribute to understanding evolutionary relationships among bacterial species. The analysis of atpB sequences from Bordetella avium compared to other Bordetella species and related genera could provide insights into pathogen evolution and host adaptation mechanisms .

How does the Bordetella avium ATP synthase compare structurally and functionally with ATP synthases from other bacterial species?

Comparative analysis of ATP synthases across bacterial species reveals important structural and functional variations:

Bordetella avium ATP synthase likely contains species-specific adaptations that reflect its lifestyle as a respiratory pathogen. Comparative studies examining sequence conservation, structural variations, and functional differences can provide insights into bacterial adaptation and potential targets for species-specific inhibitors.

The chemiosmotic mechanism is conserved across species, as demonstrated by experimental evidence showing that proton gradients drive ATP synthesis through comparable mechanisms , but subtle variations in structure and regulation may exist between different bacterial ATP synthases.

What are the optimal conditions for working with Recombinant Bordetella avium ATP synthase subunit a (atpB) in experimental settings?

Optimal working conditions for recombinant atpB include:

• Storage considerations: Store stock solution at -20°C in Tris-based buffer with 50% glycerol. For extended storage, -80°C is recommended. Working aliquots should be stored at 4°C for no more than one week to avoid degradation .

• Buffer optimization: Maintain protein in buffers containing appropriate detergents at concentrations above their critical micelle concentration to prevent aggregation.

• Temperature sensitivity: Perform experiments at controlled temperatures, typically 4-25°C, to maintain protein stability.

• pH conditions: Optimal activity is usually observed at physiological pH (7.0-7.5), though this may vary based on specific experimental objectives.

• Reconstitution parameters: When incorporating into artificial membranes, lipid composition and protein-to-lipid ratios significantly impact functional outcomes.

Researchers should validate protein quality before experiments using methods such as circular dichroism or limited proteolysis to ensure structural integrity has been maintained during storage and handling.

How can researchers investigate the role of specific amino acid residues in Bordetella avium ATP synthase subunit a (atpB) function?

Site-directed mutagenesis provides a powerful approach for investigating the functional importance of specific residues in atpB:

• Target selection: Identify conserved or functionally relevant residues based on sequence alignments, structural predictions, or computational binding site analyses .

• Mutagenesis strategy:

  • Conservative substitutions to probe subtle functional effects

  • Alanine scanning to identify essential residues

  • Charge reversals to investigate electrostatic interactions

• Functional assessment: Test mutant proteins using:

  • Proton translocation assays in reconstituted systems

  • ATP synthesis measurements

  • Structural stability analyses

• Complementation studies: Express mutant versions in bacterial systems with atpB deletions to assess in vivo functionality.

This methodological approach has been successfully applied to ATP synthases from other organisms to identify residues critical for proton conduction, subunit interactions, and assembly of the complete ATP synthase complex.

What approaches can be used to study protein-protein interactions involving Recombinant Bordetella avium ATP synthase subunit a (atpB)?

Several methodologies can elucidate protein-protein interactions involving atpB:

• Co-immunoprecipitation: Using specific antibodies against atpB or potential interaction partners to isolate protein complexes. Validated antibodies for ATP synthase components are available for such applications .

• Crosslinking studies: Chemical crosslinking followed by mass spectrometry to identify interaction interfaces.

• FRET/BRET analysis: Fluorescence or bioluminescence resonance energy transfer to study interactions in membrane environments.

• Bacterial two-hybrid systems: Modified for membrane proteins to detect interactions in a cellular context.

• Surface plasmon resonance: For quantitative measurement of binding kinetics between atpB and other purified components.

These approaches can reveal how atpB interacts with other ATP synthase subunits and potentially with regulatory proteins specific to Bordetella avium, providing insights into species-specific aspects of ATP synthase assembly and function.

How can researchers address solubility and stability issues when working with Recombinant Bordetella avium ATP synthase subunit a (atpB)?

Addressing solubility and stability challenges requires systematic optimization:

• Detergent screening: Test multiple detergent types (mild non-ionic, zwitterionic, etc.) at various concentrations to identify optimal solubilization conditions.

• Buffer optimization: Systematically vary buffer components:

  • pH range (typically 6.5-8.0)

  • Salt concentration (100-500 mM)

  • Additives (glycerol, reducing agents)

• Fusion tag strategies: Employ solubility-enhancing tags determined during the production process that can be later removed if necessary .

• Temperature management: Maintain strict temperature control during purification (typically 4°C) and avoid repeated freeze-thaw cycles.

• Stabilizing agents: Addition of specific lipids or cholesterol derivatives that can stabilize membrane proteins in solution.

Evidence suggests that these approaches can significantly improve the yield and stability of membrane proteins like atpB, enabling more reliable experimental outcomes.

What controls should be included when verifying the specificity of antibodies against Recombinant Bordetella avium ATP synthase subunit a (atpB)?

Rigorous antibody validation requires multiple controls:

• Negative controls:

  • Isotype control antibodies matched to the primary antibody

  • Samples lacking atpB expression

  • Pre-immune serum (for polyclonal antibodies)

• Positive controls:

  • Purified recombinant atpB protein

  • Cell/tissue samples with confirmed atpB expression

• Specificity validation:

  • Western blot showing single band of expected molecular weight

  • Competition assays with purified antigen

  • Validation across multiple applications (WB, ELISA, IF) as documented for available antibodies

• Cross-reactivity assessment:

  • Testing against related ATP synthase subunits

  • Testing across species to determine specificity for Bordetella avium versus other bacterial species

These controls ensure that experimental results truly reflect atpB detection rather than non-specific binding or artifacts.

How can researchers troubleshoot reconstitution experiments involving Recombinant Bordetella avium ATP synthase subunit a (atpB)?

Reconstitution experiments present specific challenges that can be addressed through systematic troubleshooting:

• Protein incorporation efficiency:

  • Verify incorporation using density gradient centrifugation

  • Assess protein:lipid ratios by analytical techniques

  • Optimize detergent removal methods (dialysis, biobeads, etc.)

• Functional activity assessment:

  • Control experiments with established proton pumps like bacteriorhodopsin

  • pH gradient verification using fluorescent indicators

  • Step-wise assembly with known functional components

• Orientation concerns:

  • Assess protein orientation in liposomes using proteolytic digestion

  • Employ asymmetric labeling strategies to determine orientation

• System integrity:

  • Measure liposome permeability and integrity

  • Verify size distribution by dynamic light scattering

These approaches mirror experimental designs used in seminal studies demonstrating the chemiosmotic mechanism, where investigators created artificial vesicles to validate ATP synthase function driven by proton gradients .

What emerging technologies might advance the study of Recombinant Bordetella avium ATP synthase subunit a (atpB)?

Several cutting-edge technologies show promise for advancing atpB research:

• Cryo-electron microscopy: High-resolution structural determination of ATP synthase complexes containing atpB in native-like environments.

• Single-molecule biophysics: Techniques to study proton conductance through individual ATP synthase complexes, revealing mechanistic details of atpB function.

• Nanodiscs and synthetic bilayers: Improved membrane mimetics for functional studies in defined lipid environments.

• Machine learning approaches: Enhanced computational prediction of binding sites and functional residues, building on existing methods that achieve 72% accuracy in ATP binding prediction .

• Genome editing in bacterial systems: CRISPR-based approaches for precise manipulation of atpB in its native context.

These technologies could overcome current limitations in understanding the structure-function relationships of atpB and its role in the complete ATP synthase complex.

How might comparative studies of ATP synthase across Bordetella species inform pathogenesis research?

Comparative analysis across Bordetella species could reveal important insights:

• Evolutionary adaptations: Identification of species-specific sequence and structural variations in atpB and other ATP synthase components.

• Host adaptation mechanisms: Correlation of ATP synthase variations with host specificity (e.g., differences between B. avium which infects birds and B. pertussis which infects humans).

• Metabolic implications: Assessment of how ATP synthase differences might contribute to varied metabolic capabilities across species.

• Drug target potential: Identification of species-specific features that could be exploited for targeted antimicrobial development.

Similar comparative approaches using gene sequences like atpB have already proven valuable in other biological systems, such as plant phylogenetics, where atpB sequences provided significant phylogenetic signal . Such methodologies could be adapted to study Bordetella evolution and pathogenesis.

What is the potential for developing targeted inhibitors against Bordetella avium ATP synthase as antimicrobial agents?

ATP synthase represents a promising antimicrobial target, with several considerations for inhibitor development:

• Structure-based drug design: Utilization of structural information and binding site predictions to design molecules specifically targeting atpB or its interactions .

• Species-specificity: Identification of unique features in Bordetella avium ATP synthase that differ from host ATP synthases to achieve selective toxicity.

• Screening methodologies:

  • Biochemical assays measuring ATP synthesis inhibition

  • Bacterial growth inhibition assays

  • Binding assays using purified components

• Delivery considerations: Development of strategies to deliver inhibitors across bacterial membranes to reach ATP synthase.

The essential nature of ATP synthase makes it an attractive target, though achieving species specificity remains a significant challenge that requires detailed comparative studies between bacterial and host ATP synthases.