Recombinant Bordetella avium Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

PlsY belongs to the family of acyltransferases (EC 2.3.1.n3) and operates in the Bordetella avium glycerolipid synthesis pathway . Key features include:

  • Substrate specificity: Utilizes acyl-phosphate as the acyl donor (not acyl-CoA or acyl-ACP) .

  • Catalytic activity: Converts acyl-phosphate + G3P → LPA + inorganic phosphate .

  • Membrane topology: Contains five transmembrane segments, with conserved cytoplasmic motifs critical for substrate binding and catalysis .

Critical residues:

  • Motif 1: Essential serine (Ser) and arginine (Arg) residues for catalysis .

  • Motif 2: Phosphate-binding loop with glycine residues critical for G3P binding .

  • Motif 3: Histidine (His) and asparagine (Asn) for structural integrity .

Recombinant Protein Characteristics

Recombinant PlsY from B. avium (strain 197N) is produced in E. coli systems for research applications. Key properties include:

PropertyDetail
UniProt IDQ2L004
Gene LocusBAV1982
Amino Acid SequenceMILTEPSPLFAALLIVLAYLIGCVPFAVVVSKLMGLKDPRSYGSKNPGATNVLRTGNKTAAALTLLGD...
Expression SystemEscherichia coli
Molecular Weight~25 kDa (predicted)
Storage ConditionsTris-based buffer with 50% glycerol; stable at -20°C or -80°C

Research Applications

  • ELISA and immunodetection: Recombinant PlsY is used as an antigen in immunological assays to study antibody responses .

  • Enzyme kinetics: Mutagenesis studies (e.g., glycine-to-alanine substitutions in Motif 2) reveal defects in Km for G3P binding .

  • Inhibition studies: Noncompetitive inhibition by palmitoyl-CoA highlights regulatory mechanisms .

Biotechnological Relevance

  • Vaccine development: While not directly used in vaccines, B. avium recombinant proteins (e.g., ompA-Fc fusions) leverage similar expression systems (Pichia pastoris) to enhance immunogenicity .

  • Antimicrobial research: Understanding PlsY’s role in membrane biogenesis aids in targeting bacterial lipid metabolism for drug discovery .

Comparative Analysis

PlsY differs from eukaryotic GPATs, which typically acylate the sn-1 position of G3P. In contrast, some plant GPATs (e.g., GPAT4/6) exhibit sn-2 preference and phosphatase activity .

Future Directions

  • Structural resolution: Cryo-EM or X-ray crystallography could elucidate substrate-binding pockets.

  • Therapeutic targeting: Inhibitors of PlsY may disrupt B. avium membrane integrity, offering avenues for antimicrobial development .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing the order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and protein stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
plsY; BAV1982; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-212
Protein Length
full length protein
Species
Bordetella avium (strain 197N)
Target Names
plsY
Target Protein Sequence
MILTEPSPLFAALLIVLAYLIGCVPFAVVVSKLMGLKDPRSYGSKNPGATNVLRTGNKTA AALTLLGDAAKGWFALWLALKLAPGLSSLGYGLVLIAVFLGHLYPVSLGFKGGKGVATAL GVLFAVSPWLALATVATWLLVAVVTRYSSLAALVAAFLAPVYYFFGGGTIWPLNAPTAAA LVGVSALLFYRHSANIDRLIKGKESRIGSKKA
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: bav:BAV1982

STRING: 360910.BAV1982

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.