Recombinant Bordetella avium Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant B. avium MsbA (UniProt ID: Not explicitly provided in sources) is produced in heterologous expression systems such as E. coli, yeast, or mammalian cells . The protein spans 591 amino acids (aa 1–591) and retains the conserved domains of ABC transporters:

  • Nucleotide-binding domain (NBD): Binds and hydrolyzes ATP.

  • Transmembrane domain (TMD): Forms a lipid-conducting channel .

Biochemical Properties (Representative Data)

PropertyDetails
Expression HostE. coli, yeast, baculovirus, or mammalian cells
TagHis-tagged (N-terminal) for purification
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in deionized water with glycerol for stability

Comparative Analysis with Orthologs

MsbA orthologs share >60% sequence identity, reflecting conserved roles in lipid transport. Below is a comparison of recombinant MsbA proteins:

SpeciesBordetella bronchiseptica Yersinia pestis Ralstonia solanacearum
Length (aa)623582592
Expression HostE. coliE. coliE. coli
ATPase ActivityNot assayedNot assayedNot assayed
Key MotifsWalker A/B, ABC signatureWalker A/BWalker A/B, Q-loop

Enzymatic Activity and Lipid A Transport

While direct data on B. avium MsbA is limited, studies on E. coli MsbA provide mechanistic insights:

  • ATP Hydrolysis: Stimulated by phospholipids and lipid A (K<sub>m</sub> = 878 μM ATP; V<sub>max</sub> = 37 nmol/min/mg) .

  • Thermosensitivity: The A270T mutation reduces activity by 45% at 42°C, highlighting structural dependence on temperature .

Research Applications

  • Antibiotic Development: MsbA is a therapeutic target due to its essential role in LPS biogenesis .

  • Membrane Protein Studies: Recombinant MsbA aids in structural biology (e.g., cryo-EM, crystallography) and drug screening .

Limitations and Future Directions

Current gaps include:

  • High-resolution structures of B. avium MsbA.

  • Functional assays validating lipid A transport kinetics.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify this in your order notes. We will then fulfill your specific request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliqouting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
msbA; BAV2229; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-591
Protein Length
full length protein
Species
Bordetella avium (strain 197N)
Target Names
msbA
Target Protein Sequence
MIPGVREATAGHEPVKAELWKRIYSRVGSHWKGLILAVLLMAGAAATQPTLAVIMKPLID GGFAGDKPQYIWSVPLAVIGLILLRGVCNFFSDYLLAWVANNVLLGIRREMFDRLLGLPD ADFKRGDTGRLLNRFTIDAGNVTGYATDVITVLVRETLVVISLIAVLLYMSWLLTVIILV VMPISVWIARSFARRLRRINRETVNMNAELTRVVSEGIDGQRVIKLFDGYEAERGRFAYV NARLRRFAMRTAVADAALTPLTQVCIAVAVGAVIAVALGQANAGTLTAGAFAAFMSALAQ IFDPIKRLTNLASKMQKMLVSAESVFTLVDQIPEVDEGQRTLAEPVRGKIEFRQIGHRFP EADRNTISDVSFTVEPGQTVALVGRSGSGKTTLVNMLPRFVLPTEGSILIDDVPINDVQL NSLRSHLSLVSQDVVLFDDTIAANVGYGALGKADDQRIHDALAAANLRDFVDSLPKGIHT PVGENAARLSGGQRQRLAIARALIKNAPILILDEATSALDNESERQVQSSLDRLMRGRTT LVIAHRLSTVQNADRIIVLDAGRIVEHGAHTELLAAGGLYATLYNMQFRED
Uniprot No.

Target Background

Function
This protein plays a crucial role in lipopolysaccharide (LPS) biosynthesis. It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore within the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: bav:BAV2229

STRING: 360910.BAV2229

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MsbA and what is its primary function in Bordetella avium?

MsbA is an essential ATP-binding cassette (ABC) transporter found in gram-negative bacteria, including Bordetella avium. Its primary function is to transport lipid A and lipopolysaccharide (LPS) from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane . This transport function is critical for the assembly of the outer membrane in gram-negative bacteria. The protein is characterized as a lipid flippase that can transport lipid A with or without core sugars across the membrane . In Bordetella avium strain 197N, the MsbA protein (UniProt accession: Q2KYS6) consists of 591 amino acids forming a complete transmembrane protein structure with ATP-binding domains .

How does the structure of MsbA from Bordetella avium compare to MsbA from other gram-negative bacteria?

The MsbA protein from Bordetella avium shares structural characteristics with MsbA proteins from other gram-negative bacteria, such as Salmonella typhimurium. All MsbA proteins contain transmembrane domains that form a portal through which lipid A can pass, and nucleotide-binding domains (NBDs) that bind and hydrolyze ATP to power the transport process . The amino acid sequence of Bordetella avium MsbA includes regions responsible for ATP binding and hydrolysis (GSGKTTLVN sequence motif) as well as transmembrane domains that create the lipid transport pathway . Comparative structural analysis shows that while the core functional domains are conserved across species, specific amino acid variations may influence substrate specificity and transport efficiency. The inward-facing conformation observed in crystal structures allows lipid A to enter the protein-enclosed transport pathway, with the separation between NBDs varying between different structural studies .

What experimental approaches can be used to study the basic properties of recombinant MsbA protein?

To study the basic properties of recombinant Bordetella avium MsbA protein, researchers can employ several methodological approaches:

  • Protein Expression and Purification: Recombinant expression systems, typically using E. coli, can be employed to produce the MsbA protein. The purification process may involve affinity chromatography, with storage in a Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage .

  • Structural Analysis: X-ray crystallography and cryo-electron microscopy (cryo-EM) have been successfully used to determine the structure of MsbA proteins. These techniques revealed different conformational states of MsbA, including inward-facing conformations that allow lipid A to access the protein-enclosed transport pathway .

  • Functional Assays: ATPase activity assays can be used to assess the functionality of purified MsbA. Active preparations typically exhibit ATPase activity in the range of 6-10 μmol ATP/min/mg protein .

  • Lipid Flipping Assays: These can be designed to measure the transport of fluorescently labeled lipid analogues or radiolabeled lipid A across membranes.

  • Stability Testing: Thermal stability assays and limited proteolysis can provide insights into the structural integrity of the purified protein under different conditions.

How does MsbA facilitate the "flip" mechanism of lipid A across the membrane, and what conformational changes are involved?

The lipid A transport mechanism by MsbA involves a complex series of conformational changes that facilitate the "flip" of lipid A across the membrane. Based on structural studies of similar MsbA proteins, the process likely follows these steps:

  • Initial Substrate Binding: In an inward-facing conformation, MsbA exhibits a large amplitude opening in the transmembrane portal that allows lipid A to enter from its site of synthesis in the cytoplasmic leaflet .

  • Trap and Flip Model: Once lipid A enters the transmembrane cavity, it becomes trapped within the protein. Electron density attributed to lipid A has been observed inside the transmembrane cavity of MsbA structures, supporting this model .

  • ATP Binding and NBD Dimerization: The binding of ATP to the nucleotide-binding domains causes them to dimerize, inducing a major conformational change that transitions the protein from an inward-facing to an outward-facing state.

  • Substrate Release: In the outward-facing conformation, lipid A is exposed to the periplasmic leaflet where it can be released. Additional electron density attributed to lipid A observed near outer surface clefts at the periplasmic ends of the transmembrane helices suggests possible post-transport docking sites .

  • ATP Hydrolysis and Reset: ATP hydrolysis releases the energy needed to reset the transporter to its inward-facing conformation, ready for another transport cycle.

These conformational changes represent a dynamic transport pathway that enables MsbA to overcome the energetic barrier of moving the large, amphipathic lipid A molecule across the hydrophobic membrane environment.

What role does ATP binding and hydrolysis play in the functional cycle of MsbA, and how can this be experimentally measured?

ATP binding and hydrolysis are essential for powering the conformational changes that drive lipid A transport by MsbA. This process can be experimentally investigated through:

  • ATPase Activity Assays: The ATPase activity of purified MsbA can be measured using colorimetric assays that detect inorganic phosphate release or coupled enzyme assays. Research has shown that MsbA preparations in certain detergents (such as FA-3) exhibit ATPase activity of 6-10 μmol ATP/min/mg protein, comparable to activity in lipid nanodiscs and significantly higher than in most other detergents .

  • Binding Affinity Measurements: Isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) can be used to determine the binding affinity of ATP to MsbA and how this is affected by the presence of lipid substrates.

  • Conformational Change Analysis: Techniques such as fluorescence resonance energy transfer (FRET) or double electron-electron resonance (DEER) spectroscopy can be used to monitor the distance changes between specific labeled residues during the ATP binding and hydrolysis cycle.

  • Mutational Studies: Targeted mutations in the ATP-binding motifs (such as the GSGKT sequence identified in the Bordetella avium MsbA) can provide insights into the relationship between ATP binding, hydrolysis, and transport function .

  • Inhibitor Studies: The effects of ATP analogs or ATPase inhibitors on MsbA function can help elucidate the specific role of different steps in the ATP hydrolysis cycle.

The ATP hydrolysis cycle is tightly coupled to the conformational changes that drive lipid A transport, with binding causing NBD dimerization and the transition to an outward-facing state, while hydrolysis enables the return to the inward-facing conformation.

What is the significance of MsbA as a potential antibiotic target, and what experimental approaches can assess its druggability?

MsbA is considered a viable target for new antibiotics due to its essential role in LPS trafficking and the assembly of the outer cell membrane in gram-negative pathogens . To assess its druggability and develop potential inhibitors, researchers can employ these methodological approaches:

  • High-Throughput Screening (HTS): Libraries of small molecules can be screened for inhibition of MsbA ATPase activity or lipid transport function.

  • Structure-Based Drug Design: The high-resolution crystal structures of MsbA, such as the 2.8 Å structure of MsbA from S. typhimurium, provide templates for computational drug design approaches .

  • Fragment-Based Screening: This approach identifies small chemical fragments that bind to different sites on MsbA and can be developed into larger, more potent inhibitors.

  • Antagonist Co-crystallization: Structural studies have successfully co-crystallized MsbA with antagonists (e.g., G907), providing insights into binding modes and potential mechanisms of inhibition .

  • Bacterial Growth Inhibition Assays: Compounds that inhibit MsbA function can be tested for their ability to inhibit the growth of Bordetella avium and other gram-negative bacteria.

  • Resistance Development Studies: Assessing the potential for resistance development against MsbA inhibitors is crucial for evaluating their long-term utility as antibiotics.

  • Specificity Profiling: Determining the specificity of potential inhibitors for bacterial MsbA versus human ABC transporters is essential for developing safe antibiotics.

Recent research has demonstrated that potent antagonists can bind to MsbA and shift it to an inactive state that is not competent for ATP hydrolysis, highlighting the potential of this approach for antibiotic development .

What are the optimal conditions for expression and purification of recombinant Bordetella avium MsbA protein?

The optimal expression and purification conditions for recombinant Bordetella avium MsbA protein involve several critical considerations:

  • Expression System: Commonly, E. coli expression systems are used for recombinant production of membrane proteins like MsbA. For Bordetella avium MsbA, the full-length protein (amino acids 1-591) can be expressed .

  • Expression Tags: Affinity tags are typically incorporated to facilitate purification. The specific tag type may be determined during the production process based on optimal expression and functionality .

  • Membrane Extraction: Effective extraction of MsbA from the membrane requires careful selection of detergents. Recent research has shown that structurally unique amphiphiles, such as FA-3, can significantly improve the stability and activity of purified MsbA .

  • Purification Protocol: A multi-step purification process typically involves:

    • Affinity chromatography using the incorporated tag

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

  • Buffer Optimization: A Tris-based buffer with 50% glycerol has been shown to be effective for storage of Bordetella avium MsbA protein .

  • Storage Conditions: The purified protein should be stored at -20°C for regular use, or at -80°C for extended storage. Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week .

  • Activity Verification: ATPase activity assays should be performed to confirm that the purified protein retains its functional properties. Preparations in optimal detergents can exhibit ATPase activity in the range of 6-10 μmol ATP/min/mg protein .

How can researchers effectively study the lipid A transport function of MsbA in vitro?

Studying the lipid A transport function of MsbA in vitro requires specialized methodologies that can detect the movement of lipids across membranes:

  • Reconstitution Systems: MsbA can be reconstituted into:

    • Proteoliposomes: Lipid vesicles containing the purified protein

    • Nanodiscs: Disc-shaped phospholipid bilayers stabilized by scaffold proteins

    • Lipid cubic phases: For structural studies of membrane proteins in a native-like environment

  • Fluorescence-Based Assays:

    • Fluorescently labeled lipid A analogues can be used to track transport across membranes

    • FRET-based assays can detect lipid movement from one leaflet to another

    • Environment-sensitive fluorescent probes can report on lipid localization changes

  • Radiolabeled Substrate Transport:

    • Radiolabeled lipid A can be used to quantitatively measure transport rates

    • Scintillation proximity assays can provide a high-throughput format for transport studies

  • Structural Approaches with Substrate:

    • Co-crystallization with lipid A, as demonstrated with S. typhimurium MsbA, can reveal substrate binding sites and conformational changes

    • Cryo-EM studies can capture different conformational states during the transport cycle

  • ATP Dependence Studies:

    • Correlating ATP hydrolysis rates with lipid transport provides insights into the coupling efficiency

    • Non-hydrolyzable ATP analogues can trap MsbA in specific conformational states

  • Computational Methods:

    • Molecular dynamics simulations can model the lipid flipping process at atomic resolution

    • Quantitative structure-activity relationship (QSAR) studies can identify key protein-lipid interactions

These methodologies should be combined for a comprehensive understanding of the MsbA-mediated lipid A transport process.

What are the challenges in crystallizing MsbA proteins, and how have researchers overcome these challenges?

The crystallization of MsbA proteins presents significant challenges due to their membrane-embedded nature and conformational flexibility. Researchers have developed several strategies to overcome these obstacles:

  • Detergent Selection: Traditional detergents often destabilize membrane proteins like MsbA, leading to aggregation or conformational heterogeneity. Researchers have developed novel amphiphiles, specifically FA-3, which has been crucial for achieving high-resolution (beyond 3 Å) crystal structures of MsbA .

  • Conformational Stabilization: The significant conformational flexibility of MsbA during its transport cycle presents challenges for crystallization:

    • Co-crystallization with antagonists (such as G907) has been successful in stabilizing specific conformations

    • Antibody fragments or nanobodies can be used to rigidify flexible regions

    • Engineering disulfide bonds can lock the protein in specific conformations

  • Lipid Incorporation: Including specific lipids during purification and crystallization can maintain the native-like environment:

    • Co-crystallization with lipid A substrate has provided insights into the transport pathway

    • Lipid cubic phase crystallization methods can preserve the membrane protein structure

  • Crystal Packing Optimization:

    • Truncation of flexible regions that might interfere with crystal contacts

    • Surface entropy reduction through targeted mutations

    • Fusion protein strategies to provide additional crystal contacts

  • Synchrotron Radiation and Data Collection:

    • The use of microfocus beamlines at synchrotron facilities has enabled data collection from microcrystals

    • Serial crystallography approaches can be applied to small or radiation-sensitive crystals

These approaches have led to significant breakthroughs, such as the 2.8 Å resolution structure of MsbA from S. typhimurium in an inward-facing conformation after co-crystallization with lipid A and utilizing the stabilizing facial amphiphile FA-3 .

How do researchers interpret electron density maps to identify lipid A binding sites in MsbA structures?

Interpreting electron density maps to identify lipid A binding sites in MsbA crystal structures requires sophisticated methodological approaches and careful analysis:

  • Difference Density Analysis:

    • Researchers generate Fo-Fc difference maps, which highlight regions where the experimental data (Fo) differs from the calculated model (Fc)

    • Positive density in these maps can indicate the presence of unmodeled ligands such as lipid A

    • Comparison of structures with and without lipid A can reveal substrate-specific density

  • Chemical Environment Assessment:

    • Putative lipid A binding sites are evaluated based on the chemical environment

    • Researchers look for clusters of hydrophobic residues that could interact with lipid A acyl chains

    • Positively charged residues that could interact with the negatively charged phosphate groups of lipid A are identified

  • Structural Validation:

    • Multiple refinement strategies are employed to confirm that the observed density is best explained by lipid A

    • Simulated annealing omit maps can be calculated to reduce model bias

    • The shape of the density is compared with the known chemical structure of lipid A

  • Functional Correlation:

    • Identified binding sites are correlated with functional data

    • Mutations of residues in putative binding sites should affect lipid A transport or binding

    • Conservation analysis across species can highlight functionally important binding residues

  • Location-Specific Analysis:

    • In MsbA structures, researchers have identified lipid A density at multiple locations:

      • Inside the transmembrane cavity, consistent with a trap and flip model

      • Near outer surface clefts at the periplasmic ends of the transmembrane helices, potentially representing post-transport docking sites

  • Model Building and Refinement:

    • Partial models of lipid A are built into the density when resolution permits

    • At lower resolutions, simplified models or just the core structure may be included

    • Iterative refinement and validation improve the accuracy of the lipid A model

These approaches have led to the identification of lipid A binding sites in MsbA structures, providing crucial insights into the transport pathway .

What computational methods can be used to analyze MsbA conformational changes during the transport cycle?

Computational methods provide powerful tools for analyzing the conformational dynamics of MsbA during its transport cycle:

  • Molecular Dynamics (MD) Simulations:

    • All-atom MD simulations can model the conformational changes of MsbA in a lipid bilayer environment

    • Coarse-grained MD simulations allow for longer timescale events to be captured

    • Enhanced sampling techniques such as targeted MD or metadynamics can explore energy barriers between different conformational states

  • Normal Mode Analysis (NMA):

    • Elastic network models can identify the intrinsic large-scale motions of MsbA

    • Principal component analysis of multiple experimental structures can reveal dominant conformational changes

    • NMA can predict transition pathways between different conformational states

  • Homology Modeling and Comparative Analysis:

    • Models of Bordetella avium MsbA can be generated based on experimental structures from related species

    • Structural alignment of multiple MsbA conformations can identify rigid domains and flexible regions

    • Sequence conservation mapping onto structures can highlight functionally important regions

  • Free Energy Calculations:

    • Computing the energetics of lipid A binding and transport through the MsbA cavity

    • Potential of mean force calculations can determine energy barriers for conformational transitions

    • Binding free energy calculations can identify key residues involved in substrate recognition

  • Network Analysis:

    • Dynamic network analysis can identify allosteric communication pathways between ATP binding sites and the transmembrane domains

    • Community analysis can reveal groups of residues that move cooperatively during conformational changes

    • Correlation analysis can detect coupled motions throughout the protein structure

  • Machine Learning Approaches:

    • Dimensionality reduction techniques can identify the essential conformational variables

    • Classification methods can categorize conformational states from simulation trajectories

    • Deep learning models can predict conformational changes based on sequence or structural features

These computational methods, when integrated with experimental data, provide a comprehensive understanding of the dynamic conformational pathway of MsbA during lipid A transport .

How can researchers quantitatively assess the impact of mutations on MsbA function and stability?

Researchers can employ several quantitative methodologies to assess the impact of mutations on MsbA function and stability:

  • ATPase Activity Assays:

    • Measurement of ATP hydrolysis rates using colorimetric or coupled enzyme assays

    • Determination of kinetic parameters (Km, Vmax, kcat) for wild-type and mutant proteins

    • Comparison of ATPase activity in different detergents or lipid environments (e.g., nanodiscs)

  • Thermal Stability Analysis:

    • Differential scanning calorimetry (DSC) to determine the melting temperature (Tm)

    • Thermofluor assays using environment-sensitive dyes to monitor protein unfolding

    • Circular dichroism (CD) spectroscopy to assess secondary structure changes with temperature

  • Lipid Transport Assays:

    • Quantitative measurement of lipid A flipping rates for wild-type and mutant proteins

    • Determination of substrate specificity changes through competition assays

    • Assessment of coupling between ATP hydrolysis and lipid transport

  • Binding Affinity Measurements:

    • Isothermal titration calorimetry (ITC) to determine binding constants for ATP and lipid substrates

    • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) to measure interaction kinetics

    • Fluorescence polarization assays for high-throughput binding studies

  • Structural Impact Assessment:

    • X-ray crystallography of mutant proteins to directly observe structural changes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics

    • Disulfide crosslinking assays to assess proximity of residues during the transport cycle

  • In Vivo Functional Complementation:

    • Growth rescue assays in MsbA-deficient bacterial strains

    • Lipid A transport efficiency in cellular systems

    • Resistance to antibiotics targeting the outer membrane

  • Comparative Mutational Analysis:

    • Construction of mutation impact matrices for functional regions

    • Deep mutational scanning to comprehensively assess all possible mutations

    • Evolutionary conservation analysis to prioritize functionally important residues

The following table summarizes typical effects of mutations in different MsbA domains:

DomainMutation TypeTypical Effect on ATPase ActivityEffect on Lipid TransportStructural Impact
NBD Walker A MotifConservative (e.g., K→R)50-90% reductionSeverely impairedMinimal
NBD Walker A MotifNon-conservative (e.g., K→A)>95% reductionAbolishedMinimal
NBD Walker B MotifConservative (e.g., E→D)70-95% reductionSeverely impairedMinimal
NBD Walker B MotifNon-conservative (e.g., E→A)>95% reductionAbolishedMinimal
Transmembrane PortalHydrophobic→Charged20-50% reductionModerately impairedSignificant
Transmembrane PortalSize-altering10-30% reductionSubstrate specificity alteredModerate
NBD-TMD InterfaceAny substitutionVariableCoupling efficiency reducedModerate to significant
Periplasmic LoopsCharge reversalMinimal effectRelease kinetics alteredMinimal

This quantitative assessment provides crucial insights into structure-function relationships and helps identify residues critical for MsbA function.

What are the current limitations in our understanding of MsbA function in Bordetella avium, and how might these be addressed?

Despite significant advances in our understanding of MsbA protein structure and function, several limitations remain in our knowledge of Bordetella avium MsbA specifically:

  • Species-Specific Structural Information:

    • While high-resolution structures exist for MsbA from species like S. typhimurium, no crystal structure specifically of Bordetella avium MsbA has been reported .

    • Future Approach: Crystallization trials using the successful strategies employed for other MsbA proteins, such as the use of FA-3 amphiphile and co-crystallization with lipid A or antagonists .

  • Transport Kinetics Data:

    • Quantitative data on lipid A transport rates and substrate specificity for B. avium MsbA is lacking.

    • Future Approach: Development of in vitro reconstitution systems and fluorescence-based assays specifically optimized for B. avium MsbA.

  • Physiological Relevance in Host-Pathogen Interactions:

    • The role of MsbA in B. avium virulence and host-pathogen interactions remains poorly characterized.

    • Future Approach: Animal infection models with wild-type and MsbA-mutant B. avium strains, combined with transcriptomic and proteomic analyses under infection-relevant conditions.

  • Interaction with Other LPS Biosynthesis Components:

    • The coordination between MsbA and other proteins involved in LPS biosynthesis in B. avium is not well understood.

    • Future Approach: Protein-protein interaction studies using techniques like crosslinking mass spectrometry or proximity labeling.

  • Lipid A Structural Variations:

    • How structural variations in B. avium lipid A affect MsbA transport efficiency is unknown.

    • Future Approach: Comparative transport studies using lipid A variants isolated from B. avium under different growth conditions.

  • Regulatory Mechanisms:

    • Mechanisms regulating MsbA expression and activity in response to environmental stresses remain uncharacterized.

    • Future Approach: Reporter gene assays and promoter analysis combined with site-directed mutagenesis of potential regulatory elements.

  • Antibiotic Development Potential:

    • The druggability of B. avium MsbA as an antibiotic target needs further exploration.

    • Future Approach: High-throughput screening for B. avium MsbA-specific inhibitors and validation in bacterial growth assays.

Addressing these limitations will require interdisciplinary approaches combining structural biology, biochemistry, microbiology, and computational methods.

How can researchers differentiate between the roles of MsbA as a lipid A flippase versus a glycerophospholipid flippase?

MsbA has been implicated in the transport of both lipid A and glycerophospholipids, but differentiating between these functions presents methodological challenges. Researchers can employ the following approaches:

  • Substrate Competition Assays:

    • In vitro transport assays with differentially labeled lipid A and glycerophospholipids

    • Determination of transport kinetics and substrate preference through competition experiments

    • Analysis of how mutations affect transport of different substrate classes

  • Site-Directed Mutagenesis:

    • Identification of residues specifically involved in lipid A recognition through structural analysis

    • Generation of mutants that selectively affect lipid A binding without altering glycerophospholipid transport

    • Functional characterization of these substrate-specific mutants in vitro and in vivo

  • Conditional Depletion Studies:

    • Use of conditional MsbA expression strains combined with metabolic labeling of different lipid classes

    • Time-course analysis of lipid accumulation in the cytoplasmic leaflet upon MsbA depletion

    • Complementation with MsbA variants to assess rescue of specific lipid transport defects

  • Structural Studies with Different Substrates:

    • Co-crystallization or cryo-EM studies of MsbA with different substrates

    • Comparison of binding sites and conformational changes induced by lipid A versus glycerophospholipids

    • Molecular dynamics simulations to assess the energetics of different substrate transport pathways

  • In vivo Lipid Distribution Analysis:

    • Development of fluorescent or clickable lipid probes that can distinguish between lipid classes

    • Microscopy-based approaches to visualize the subcellular distribution of different lipids in wild-type versus MsbA-mutant strains

    • Lipidomic analysis of membrane leaflet composition using selective labeling techniques

  • Genetic Bypass Studies:

    • Identification of alternative glycerophospholipid flippases that can compensate for MsbA deficiency

    • Construction of double mutants to reveal functional redundancies

    • Investigation of synthetic lethal interactions that might reveal substrate-specific pathways

The following table compares key experimental features that can help distinguish between these dual roles:

Experimental FeatureLipid A Flippase ActivityGlycerophospholipid Flippase Activity
Substrate SizeLarge (>2000 Da)Smaller (~700-900 Da)
Transport KineticsGenerally slowerTypically faster
ATP DependenceStrict requirementMay show some basal activity without ATP
Temperature SensitivityMore sensitive to temperatureMore robust across temperature range
Competitive InhibitionInhibited by LPS core oligosaccharidesInhibited by other phospholipids
Mutational SensitivityHighly sensitive to transmembrane portal mutationsMore tolerant to certain mutations
In vivo PhenotypesSevere outer membrane defectsPhospholipid distribution abnormalities

Through these approaches, researchers can dissect the dual functionality of MsbA and understand how this ABC transporter accommodates different substrate classes.

What novel therapeutic strategies might emerge from a deeper understanding of MsbA structure and function?

A comprehensive understanding of MsbA structure and function in Bordetella avium and other gram-negative bacteria could lead to several novel therapeutic strategies:

  • Structure-Based Inhibitor Design:

    • The high-resolution structures of MsbA in different conformational states provide templates for computational drug design

    • Virtual screening of compound libraries against specific binding pockets

    • Fragment-based approaches to develop inhibitors targeting critical functional sites

    • Rational design of transition-state inhibitors that interfere with the ATP hydrolysis cycle

  • Allosteric Modulators:

    • Identification of allosteric sites that can lock MsbA in inactive conformations

    • Development of compounds that disrupt the coupling between ATP hydrolysis and lipid transport

    • Design of molecules that interfere with the large conformational changes required for transport

  • Substrate Competitive Inhibitors:

    • Design of lipid A analogues that bind to MsbA but cannot be transported

    • Development of compounds that occupy the lipid A binding site but are too large to be flipped

    • Creation of "molecular plugs" that bind at the entry of the transmembrane portal

  • Combination Therapies:

    • Synergistic approaches targeting both MsbA and other components of the LPS transport pathway

    • MsbA inhibitors combined with outer membrane permeabilizers

    • Dual-targeting compounds that affect both MsbA and other essential processes

  • Species-Selective Targeting:

    • Exploitation of species-specific differences in MsbA structure for selective inhibition

    • Design of narrow-spectrum antibiotics that target pathogen-specific features of MsbA

    • Development of compounds that exploit variations in the lipid A binding pocket between species

  • Antibody-Based Approaches:

    • Generation of antibodies or nanobodies against extracellular loops of MsbA

    • Development of antibody-drug conjugates for targeted delivery of inhibitors

    • Immunotherapeutic approaches harnessing the host immune system

  • Novel Delivery Systems:

    • Nanoparticle-based delivery of MsbA inhibitors to enhance penetration of the outer membrane

    • Trojan horse strategies using natural bacterial uptake mechanisms

    • Bacteriophage-based delivery of inhibitors or CRISPR-Cas systems targeting msbA genes

Potential therapeutic developments are summarized in the following table:

Therapeutic ApproachMechanism of ActionAdvantagesChallenges
ATP-binding site inhibitorsPrevent ATP binding and hydrolysisBased on well-characterized binding pocketPotential cross-reactivity with human ABC transporters
Transmembrane domain inhibitorsBlock lipid A binding or transportPotentially high specificity for bacterial MsbADifficulty in achieving membrane penetration
Allosteric inhibitorsLock MsbA in inactive conformationNovel mode of action, potentially lower resistanceComplex structure-activity relationships
Lipid A mimeticsCompete with natural substrateHigh specificity for targetChallenging pharmaceutical properties of lipid-like molecules
Covalent inhibitorsForm irreversible bonds with MsbALong-lasting inhibitionPotential off-target reactivity
Conformational antibodiesRecognize and lock specific MsbA conformationsHighly specific, long half-lifeLimited penetration into bacterial periplasm
Gene-silencing approachesReduce MsbA expressionNovel mechanism, potentially synergisticDelivery of nucleic acids into bacteria is challenging

These therapeutic strategies represent promising avenues for developing new antibiotics against gram-negative pathogens that are increasingly resistant to conventional treatments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.