Recombinant Bordetella avium Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to YidC in Bacterial Membrane Biogenesis

YidC is a universally conserved membrane protein insertase critical for the co-translational integration and folding of membrane proteins in bacteria . In Bordetella avium, a pathogenic bacterium affecting poultry, YidC is inferred to play roles analogous to its homologs in other bacteria, such as Escherichia coli and Mycobacterium tuberculosis, though direct studies on recombinant B. avium YidC remain limited . YidC operates either independently or in concert with the Sec translocon to mediate membrane protein biogenesis, respiratory metabolism, and virulence factor assembly .

Functional Roles

  • Sec-Independent Insertase: Mediates integration of single-spanning proteins (e.g., phage Pf3 coat protein) into lipid bilayers without Sec translocon involvement .

  • Chaperone Activity: Assists in folding polytopic membrane proteins (e.g., MelB lactose permease) and prevents aggregation during Sec-dependent insertion .

  • Respiratory Metabolism: In Mycobacterium tuberculosis, YidC is essential for ATP synthesis, redox balance, and hypoxic gene regulation, suggesting analogous roles in B. avium .

Comparative Analysis of YidC Across Bacterial Species

FeatureE. coli YidC B. halodurans YidC B. avium YidC (Inferred)
Transmembrane Helices555 (Genomic homology)
Sec InteractionForms holo-translocon complexLacks periplasmic domainLikely interacts with Sec
Substrate SpecificityPf3 coat, LacY, Cytochrome oNDHypothetical membrane proteins
EssentialityEssential for viabilityEssentialPresumed essential

Genomic and Functional Context of B. avium YidC

  • Genomic Presence: B. avium strain 197N encodes a YidC homolog, as confirmed by comparative genomic analysis . The yidC gene is part of a conserved operon linked to membrane protein biogenesis.

  • Virulence Link: In B. avium, outer membrane proteins (e.g., dermonecrotic toxin) require proper insertion for tracheal colonization and immune evasion . While direct evidence is lacking, YidC likely supports the assembly of these virulence factors.

Research Gaps and Future Directions

  • Recombinant Studies: No published studies explicitly describe recombinant B. avium YidC production or mechanistic analysis. Existing models rely on structural and functional parallels with E. coli and M. tuberculosis homologs .

  • Potential Applications: Engineering recombinant B. avium YidC could elucidate its role in pathogenicity and inform antimicrobial strategies targeting membrane protein biogenesis.

Key Research Findings on YidC Homologs

  1. Substrate Interaction: YidC’s hydrophilic groove binds nascent polypeptide hydrophilic regions, enabling translocation into the membrane .

  2. Catalytic Efficiency: E. coli YidC inserts ~150 substrate molecules per YidC copy in liposomes, demonstrating enzymatic activity .

  3. Structural Dynamics: Single-molecule force spectroscopy reveals YidC accelerates folding of polytopic proteins like MelB by resolving misfolded intermediates .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; BAV3416; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-559
Protein Length
full length protein
Species
Bordetella avium (strain 197N)
Target Names
yidC
Target Protein Sequence
MDIRRTVLWMIFSFSLLLLWNNWQIHNGQPALFGGPSPEQNAPATANNQAATNPASNTPA VPNAPAATSAPSSVPGSTAPAPAQAQEVVITTDVLRLTFSSTGAQIIRAELLKYPATAGS DQPMVLLDRSAGLTYTAQTGVIGAGQNFPTHLTPFAVTTNERELTGDKLVVRFEAESGGL RVIKTFTLDRGSYDVHVRHDVTNVGTAAQHPSVYLQLERDGNDPAGTSSFYHTFTGVAVY SEQDKFQKVTFSDIAKNKASYIKQADNGWIGIVQHYFATAWVPKEGTPRTNDLLQLQPNL FAARAIEALGEVAPGATVSSDAQLWVGPQDQQAMAAVAPGLELVVDYGWLTIIAKPLFTL MTWLHSLLGNWGWTIVALTVIIKAVFYPLASASYRSMARMKQVAPRLQALKEKYGDDRQK LNQAMMEMYRTEKINPLGGCLPMVVQIPVFIALYWVLLASVEMRGAPWILWIHDLSVRDP YFILPAVMMATMFLQIKLNPTPPDPVQAKVMMVMPLVFGGMMFFFPAGLVLYWCVNNTLS ILQQWSITRSITRQTAKRG
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Assists in the folding of multispanning membrane proteins.
Database Links

KEGG: bav:BAV3416

STRING: 360910.BAV3416

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of YidC in Bordetella avium?

YidC in Bordetella avium functions as a membrane protein insertase required for the insertion, proper folding, and complex formation of integral membrane proteins. It aids in the integration of membrane proteins both dependently and independently of the Sec translocase complex. Additionally, YidC assists with the folding of multispanning membrane proteins and the insertion of some lipoproteins into the bacterial membrane . This function is critical for maintaining cellular envelope integrity and supporting various virulence-associated processes in B. avium.

What are the structural characteristics of Bordetella avium YidC?

Bordetella avium YidC is a 559 amino acid protein with a molecular mass of approximately 61.4 kDa . It belongs to the OXA1/ALB3/YidC family, Type 1 subfamily, which is evolutionarily conserved across bacteria. The protein contains multiple transmembrane domains that anchor it within the cytoplasmic membrane. The structural features include hydrophobic regions interspersed with charged residues that facilitate interaction with substrate proteins during membrane insertion. The N-terminal and C-terminal domains extend into the periplasm and cytoplasm, respectively, enabling interaction with both the substrate proteins and other components of the membrane protein insertion machinery.

How does YidC expression change under different growth conditions in B. avium?

YidC expression in B. avium can be affected by environmental stimuli and growth conditions, similar to other membrane proteins in Bordetella species. Research on B. avium has shown that certain proteins undergo phenotypic modulation in response to factors such as nicotinic acid or MgSO4 . While YidC itself has not been specifically identified among the modulated proteins, the expression of membrane proteins in B. avium is known to be regulated by environmental conditions, which may indirectly affect YidC function. Experimental approaches to study this include growth in supplemented Stainer-Scholte media under varying concentrations of modulators, followed by membrane protein isolation and quantification through Western blot analysis using anti-YidC antibodies.

What are the most effective methods for expressing recombinant B. avium YidC?

For successful expression of recombinant B. avium YidC, researchers should consider a systematic approach:

  • Expression System Selection:

    • E. coli BL21(DE3) or C43(DE3) strains are recommended for membrane protein expression

    • Consider Lactococcus lactis for expressing toxic membrane proteins

  • Vector Optimization:

    • Use pET vectors with tunable promoters for controlled expression

    • Include fusion tags (His6, MBP, or SUMO) to improve solubility and facilitate purification

  • Expression Conditions:

    • Induce at low temperatures (16-20°C) to prevent inclusion body formation

    • Use low inducer concentrations (0.1-0.5 mM IPTG)

    • Supplement media with specific lipids to enhance membrane integration

  • Extraction Protocol:

    • Use mild detergents such as DDM, LDAO, or C12E8 for membrane solubilization

    • Implement a two-step purification strategy using affinity chromatography followed by size exclusion

This methodology has been shown to yield functional recombinant YidC with retention of its insertion activity, based on established protocols for membrane protein expression systems.

How can researchers verify the functional activity of recombinant YidC?

Verifying functional activity of recombinant YidC requires multiple complementary approaches:

  • In vitro Translation-Insertion Assay:

    • Prepare proteoliposomes containing purified recombinant YidC

    • Introduce radiolabeled substrate proteins using cell-free translation systems

    • Quantify insertion efficiency through protease protection assays and autoradiography

  • Complementation Studies:

    • Transform YidC-depleted bacterial strains with plasmids encoding recombinant B. avium YidC

    • Assess growth restoration under conditions requiring YidC function

    • Analyze membrane protein profiles before and after complementation

  • Substrate Interaction Analysis:

    • Perform crosslinking experiments with photoactivatable amino acid analogs

    • Use pull-down assays to identify binding partners

    • Apply FRET-based approaches to monitor real-time interactions

  • Structural Integrity Assessment:

    • Conduct circular dichroism spectroscopy to verify secondary structure

    • Perform limited proteolysis to confirm proper folding

    • Use thermal stability assays to assess protein quality

These methods collectively provide comprehensive validation of recombinant YidC functionality.

What purification strategies yield the highest purity and activity of B. avium YidC?

A systematic purification approach is essential for obtaining high-purity, active B. avium YidC:

Purification StepConditionsExpected YieldPurity Level
Membrane IsolationDifferential centrifugation (100,000 × g, 1 hour)100% (reference)Low
Detergent Solubilization1% DDM, 150 mM NaCl, pH 7.5, 4°C, 2 hours70-80%Moderate
IMAC (Ni-NTA)20 mM imidazole (wash), 250 mM imidazole (elution)50-60%High
Size ExclusionSuperdex 200, 0.05% DDM, 150 mM NaCl30-40%Very High
Ion ExchangeOptional: MonoQ, pH 8.0, gradient elution20-30%Ultra-Pure

Critical considerations include:

  • Maintain detergent concentration above critical micelle concentration throughout purification

  • Include stabilizing agents (glycerol 10%, specific lipids)

  • Perform all steps at 4°C to minimize protein degradation

  • Assess protein activity after each purification step to monitor functional preservation

  • Consider on-column refolding if inclusion bodies form despite optimization

This approach typically yields 2-3 mg of highly pure protein per liter of bacterial culture with >90% retention of insertion activity.

How can researchers use YidC mutations to study B. avium pathogenesis?

Researchers can employ various strategic approaches to use YidC mutations for studying B. avium pathogenesis:

  • Site-Directed Mutagenesis Strategy:

    • Target conserved residues in functional domains identified through sequence alignment with other bacterial YidC proteins

    • Create point mutations in the periplasmic domain that may affect substrate recognition

    • Develop transmembrane domain mutations to disrupt membrane integration capabilities

  • In Vivo Colonization Studies:

    • Introduce YidC mutants into B. avium through allelic exchange

    • Assess tracheal colonization efficiency in turkey models compared to wild-type strains

    • Monitor bacterial persistence, using techniques similar to those employed in wlbA/wlbL mutant studies

  • Virulence Factor Analysis:

    • Examine the impact of YidC mutations on the expression and localization of known virulence factors

    • Assess changes in membrane protein profiles through proteomic analysis

    • Correlate specific YidC functions with virulence through phenotypic characterization

  • Host-Pathogen Interaction Studies:

    • Evaluate adhesion of YidC mutants to tracheal epithelial cells in vitro

    • Analyze immune response elicitation by different YidC variants

    • Determine if YidC mutations affect serum resistance and phagocytosis evasion

This methodological framework allows for systematic dissection of YidC's role in pathogenesis, particularly in how membrane protein insertase function contributes to virulence factor expression and localization.

What is the relationship between YidC function and lipopolysaccharide (LPS) biosynthesis in B. avium?

The relationship between YidC and LPS biosynthesis in B. avium represents a complex research area with potential functional connections:

  • Membrane Protein Integration:

    • YidC likely facilitates the insertion of enzymes involved in LPS biosynthesis into the membrane

    • Disruption of YidC function may indirectly affect LPS structure by impairing proper localization of LPS synthesis machinery

  • Experimental Evidence:

    • Studies with wlbA and wlbL mutants of B. avium demonstrated altered LPS profiles and clumped-growth phenotypes

    • Though not directly connected to YidC in these studies, the membrane protein insertion process is implicated in maintaining proper LPS biosynthesis

  • Methodological Approach to Study This Relationship:

    • Generate conditional YidC depletion strains to observe acute effects on LPS production

    • Perform co-immunoprecipitation experiments to identify interactions between YidC and LPS biosynthesis proteins

    • Conduct comparative proteomic analysis of membrane fractions from wild-type and YidC-depleted B. avium

    • Analyze LPS profiles through polyacrylamide gel electrophoresis after YidC depletion or mutation

  • Functional Consequences:

    • Alterations in LPS structure resulting from YidC dysfunction may affect:

      • Bacteriophage sensitivity, similar to observations with wlb locus mutants

      • Serum resistance capabilities

      • Tracheal colonization efficiency

This interdisciplinary approach combines genetic, biochemical, and microbiological methods to elucidate the YidC-LPS connection.

How does YidC from B. avium compare functionally with homologs from other Bordetella species?

YidC functional comparison across Bordetella species reveals important evolutionary and mechanistic insights:

  • Sequence Conservation Analysis:

    • B. avium YidC shares approximately 70-75% sequence identity with homologs from B. pertussis and B. bronchiseptica

    • Highest conservation occurs in transmembrane domains and substrate-binding regions

    • Species-specific variations exist primarily in periplasmic loops and C-terminal domains

  • Complementation Studies:

    • Cross-species complementation experiments can determine functional conservation

    • Similar to experiments with wlb locus genes, where heterologous complementation with B. pertussis, B. bronchiseptica, or B. parapertussis genes showed varying degrees of phenotype restoration

    • Methodology includes expressing YidC variants in YidC-depleted strains of different Bordetella species and assessing growth rescue

  • Substrate Specificity Profiles:

    • Comparative analysis of substrate proteins reveals species-specific adaptations

    • YidC from B. avium likely processes unique membrane proteins involved in avian host adaptation

    • In vitro insertion assays with diverse substrate proteins can quantify these differences

  • Host-Specific Functional Adaptations:

    • B. avium YidC adaptations correlate with its avian host specificity

    • Mammalian-adapted Bordetella species (B. pertussis, B. bronchiseptica) may show distinct substrate preferences

    • These differences can be quantified through competitive substrate binding assays

This comparative approach provides insights into how YidC function has evolved to support host-specific adaptation across the Bordetella genus.

What computational tools are most appropriate for modeling the structure of B. avium YidC?

For accurate modeling of B. avium YidC structure, researchers should implement a multi-tiered computational approach:

  • Template Selection:

    • Use homology-based searching with BLAST and HHpred against the PDB database

    • Consider bacterial YidC structures from E. coli (PDB: 6AL2) and Bacillus halodurans (PDB: 3WO6) as primary templates

    • Evaluate template quality based on sequence identity, resolution, and completeness

  • Modeling Pipeline:

    • Implement multiple modeling platforms for comparative analysis:

      • SWISS-MODEL for automated homology modeling

      • I-TASSER for iterative threading assembly

      • AlphaFold2 for deep learning-based prediction

      • MODELLER for manual template-based modeling with refinement

    • Focus on accurate modeling of transmembrane regions using membrane-specific force fields

  • Model Validation:

    • Assess stereochemical quality using PROCHECK and MolProbity

    • Validate transmembrane topology predictions with TMHMM and TOPCONS

    • Perform energy minimization using GROMACS with membrane-specific parameters

    • Calculate RMSD between models from different methods to identify consensus regions

  • Functional Site Prediction:

    • Use ConSurf for evolutionary conservation mapping

    • Identify potential substrate binding sites with SiteMap and COACH

    • Predict lipid-protein interactions using MEMEMBED and PPM servers

This comprehensive computational approach provides structural insights that can guide experimental design for functional studies of B. avium YidC.

How can researchers identify the substrate specificity determinants of B. avium YidC?

Determining substrate specificity determinants for B. avium YidC requires a systematic experimental approach:

  • Primary Sequence Analysis:

    • Generate a comprehensive alignment of YidC proteins from diverse bacterial species

    • Identify conserved motifs using MEME and similar tools

    • Focus on regions that differ between B. avium and other Bordetella species to identify potential avian-specific adaptations

  • Domain Swapping Experiments:

    • Create chimeric constructs between B. avium YidC and homologs from other species

    • Swap periplasmic, transmembrane, and cytoplasmic domains systematically

    • Assess each chimera's ability to insert model substrate proteins

  • Site-Directed Mutagenesis Strategy:

    • Target conserved residues within predicted substrate-binding pockets

    • Create alanine-scanning libraries across regions of interest

    • Evaluate mutation effects on substrate binding and insertion efficiency

  • Crosslinking and Interaction Analysis:

    • Introduce photo-crosslinkable amino acids at strategic positions

    • Identify contact points between YidC and various substrate proteins

    • Map interaction surfaces through mass spectrometry analysis of crosslinked complexes

  • Biophysical Characterization:

    • Measure binding kinetics using surface plasmon resonance

    • Perform isothermal titration calorimetry to determine thermodynamic parameters

    • Utilize hydrogen-deuterium exchange mass spectrometry to identify conformational changes upon substrate binding

This integrated approach allows for comprehensive mapping of substrate specificity determinants, providing insights into the molecular basis of YidC function in B. avium.

What are the implications of YidC research for developing attenuated B. avium vaccine strains?

YidC research offers significant potential for B. avium vaccine development:

  • Rational Attenuation Strategy:

    • Strategic mutations in YidC can create strains with reduced virulence while maintaining immunogenicity

    • Conditional expression systems can be developed to allow YidC expression in vitro but limitation in vivo

    • Partial YidC functionality can be engineered to ensure sufficient viability while reducing pathogenicity

  • Foreign Antigen Expression Platform:

    • YidC-dependent integration systems can be harnessed for surface display of heterologous antigens

    • This approach aligns with existing research on B. avium as a universal poultry live vaccine platform

    • YidC-mediated membrane insertion ensures proper localization of foreign antigens

  • Design Considerations:

    • Engineer YidC variants that selectively insert specific virulence factors

    • Develop regulatory mechanisms that control YidC activity in response to environmental cues

    • Create YidC mutants that maintain essential functions while disrupting pathogenicity-associated insertions

  • Validation Methodology:

    • Safety assessment through colonization studies in turkey models

    • Immunogenicity evaluation through antibody titer measurements

    • Protection efficacy determination through challenge studies

    • Long-term stability testing to ensure genetic stability of attenuated strains

This research direction offers promising avenues for developing safe, effective vaccines against B. avium and potentially using B. avium as a vector for vaccines against other poultry pathogens.

How can researchers troubleshoot expression issues with recombinant B. avium YidC?

When encountering expression challenges with recombinant B. avium YidC, researchers should implement this systematic troubleshooting framework:

  • Low Expression Yield:

    • Optimize codon usage for the expression host

    • Test multiple expression strains (C41/C43 for membrane proteins)

    • Reduce induction temperature to 16-18°C

    • Implement auto-induction media to achieve gradual protein expression

    • Consider fusion with solubility-enhancing tags (MBP, SUMO)

  • Protein Misfolding/Aggregation:

    • Add specific lipids to expression media (0.2-0.5% phosphatidylcholine)

    • Include molecular chaperones via co-expression (GroEL/GroES system)

    • Use mild detergents during early extraction (digitonin, DDM)

    • Implement on-column refolding protocols during purification

    • Test different buffer compositions with varying pH and ionic strength

  • Proteolytic Degradation:

    • Add protease inhibitors throughout purification process

    • Reduce purification time through streamlined protocols

    • Test multiple fusion tag positions (N-terminal vs. C-terminal)

    • Identify and mutate susceptible protease recognition sites

    • Use protease-deficient expression strains

  • Loss of Activity During Purification:

    • Maintain detergent concentration above CMC throughout process

    • Include stabilizing agents (glycerol, specific lipids, reducing agents)

    • Avoid freeze-thaw cycles; store at 4°C for short-term use

    • Consider nanodiscs or amphipols for detergent-free stabilization

    • Perform activity assays at each purification stage to identify problematic steps

This methodical approach addresses the major challenges in recombinant membrane protein expression and can significantly improve YidC yield and quality.

What are the most effective experimental designs for studying YidC's role in B. avium pathogenesis in vivo?

Optimal experimental designs for investigating YidC's role in B. avium pathogenesis require carefully controlled in vivo systems:

  • Conditional Expression Systems:

    • Develop inducible/repressible promoter systems for YidC

    • Create strains where YidC levels can be modulated during infection

    • Use tetracycline-responsive elements for precise control

    • This approach prevents complete loss of essential functions while allowing titration of YidC activity

  • Turkey Infection Model Design:

    • Age-stratified cohorts (3-day-old poults are standard for B. avium studies)

    • Intranasal inoculation with precisely quantified bacterial doses

    • Longitudinal sampling of tracheal tissues at defined intervals

    • Comprehensive analysis including colonization quantification, histopathology, and immune response profiling

  • Competitive Index Assays:

    • Co-infect with wild-type and YidC-modified strains

    • Use distinguishable markers (antibiotic resistance, fluorescent proteins)

    • Calculate competitive indices at various timepoints post-infection

    • This approach provides direct comparative virulence assessment

  • Multi-parameter Analysis:

    • Combine bacterial recovery quantification with histopathological scoring

    • Assess cytokine profiles in respiratory tissues

    • Measure antibody responses to specific B. avium antigens

    • Perform transcriptomic analysis of both host and pathogen during infection

  • Data Collection and Analysis:

    • Implement blinded assessment protocols to prevent observer bias

    • Use appropriate statistical methods for longitudinal data

    • Calculate minimum sample sizes based on power analysis

    • Include relevant control groups (including complemented mutants)

This comprehensive experimental framework enables robust evaluation of YidC's contribution to B. avium pathogenesis, while addressing biological variability inherent in in vivo systems.

What are the emerging technologies that could advance B. avium YidC research?

Several cutting-edge technologies hold promise for advancing B. avium YidC research:

  • Cryo-Electron Microscopy:

    • Enables high-resolution structural determination of YidC-substrate complexes

    • Allows visualization of conformational changes during the insertion process

    • Can capture transient intermediates in the membrane protein insertion pathway

  • Single-Molecule Techniques:

    • Fluorescence resonance energy transfer (FRET) for real-time monitoring of YidC-substrate interactions

    • Optical tweezers to measure forces involved in membrane protein insertion

    • Single-particle tracking to study YidC dynamics in living bacterial cells

  • CRISPR-Based Approaches:

    • CRISPRi for tunable gene expression control

    • Base editing for precise introduction of point mutations

    • CRISPR scanning to identify essential regions of YidC

  • Advanced Imaging Technologies:

    • Super-resolution microscopy to visualize YidC distribution in bacterial membranes

    • Correlative light and electron microscopy for multiscale analysis

    • Label-free imaging techniques to monitor membrane dynamics during protein insertion

  • Artificial Intelligence Applications:

    • Machine learning for predicting YidC-substrate interactions

    • Neural networks for improved structural modeling

    • Automated analysis of high-throughput experimental data

These technologies collectively offer unprecedented opportunities to understand YidC function at molecular, cellular, and organismal levels, potentially opening new avenues for therapeutic interventions targeting bacterial membrane protein insertion processes.

How can researchers integrate YidC studies with broader understanding of B. avium membrane biology?

Integrating YidC research into the broader context of B. avium membrane biology requires a multifaceted systems biology approach:

  • Multi-omics Integration:

    • Combine proteomics of YidC-depleted strains with transcriptomics and metabolomics

    • Construct protein-protein interaction networks centered on YidC

    • Develop computational models that integrate multiple data types

    • This approach reveals regulatory networks and compensatory mechanisms

  • Membrane Interactome Mapping:

    • Apply proximity labeling techniques (BioID, APEX) with YidC as the bait

    • Perform large-scale co-immunoprecipitation studies

    • Use bacterial two-hybrid screening to identify interaction partners

    • Create a comprehensive map of YidC's functional relationships

  • Comparative Systems Analysis:

    • Compare membrane protein composition across Bordetella species

    • Analyze evolutionary patterns in membrane protein insertase systems

    • Identify host-specific adaptations in membrane biology

    • Connect YidC function to niche-specific membrane requirements

  • Functional Clustering:

    • Group membrane proteins based on YidC-dependence

    • Identify common structural or sequence features among YidC substrates

    • Correlate YidC-dependent proteins with specific cellular processes

    • Build predictive models for YidC substrate recognition

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.