Recombinant Bordetella avium NADH-quinone oxidoreductase subunit K (nuoK)

What is the basic structure of Bordetella avium NADH-quinone oxidoreductase subunit K?

NADH-quinone oxidoreductase subunit K (nuoK) in Bordetella species is a small, hydrophobic membrane protein that forms part of the respiratory complex I. While specific structural data for B. avium nuoK is limited, comparative analysis with similar proteins like that of B. petrii suggests it consists of approximately 100-105 amino acids. The protein typically contains multiple transmembrane domains with a highly conserved amino acid sequence that includes hydrophobic residues essential for membrane integration. Based on data from related Bordetella species, the protein likely displays a characteristic structure with transmembrane helices that anchor it within the bacterial membrane .

How does nuoK function within the respiratory chain of Bordetella avium?

NuoK functions as an integral component of NADH-quinone oxidoreductase (Complex I) in the electron transport chain of B. avium. This complex catalyzes the transfer of electrons from NADH to quinones, coupled with proton translocation across the membrane. NuoK specifically contributes to the membrane domain of Complex I and participates in forming the proton translocation pathway. The protein works in conjunction with other subunits to establish the proton gradient necessary for ATP synthesis. Research on respiratory pathways in various bacterial species has demonstrated that nuoK and other NADH-quinone oxidoreductase subunits are essential for energy metabolism in both aerobic and anaerobic conditions .

How conserved is the nuoK sequence across different Bordetella species?

Sequence analysis of NADH-quinone oxidoreductase components across Bordetella species reveals significant conservation of nuoK. While specific B. avium nuoK sequence polymorphism data is not provided in the search results, research on other Bordetella genes shows minimal sequence variation over extended periods. For example, analysis of 72 B. avium isolates from diverse geographic locations spanning at least 25 years revealed only three occasional sequence polymorphisms in certain genetic targets . Similar conservation patterns likely apply to nuoK, making it a potentially stable target for identification and functional studies across Bordetella species.

What expression systems are most effective for producing recombinant B. avium nuoK protein?

E. coli expression systems are predominantly used for recombinant production of membrane proteins like nuoK. Based on protocols for similar proteins, such as B. petrii nuoK, E. coli provides a practical host for expression due to its rapid growth, well-established genetic tools, and compatibility with hydrophobic membrane proteins . For optimal expression, researchers should consider using E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3). Expression vectors containing T7 or tac promoters with N-terminal or C-terminal His-tags facilitate both expression control and subsequent purification. Codon optimization may be necessary when expressing B. avium proteins in E. coli to address potential codon usage bias.

What are the optimal conditions for solubilizing and purifying recombinant nuoK protein?

Solubilization and purification of hydrophobic membrane proteins like nuoK requires specific methodological considerations:

• Solubilization: After cell lysis, membrane fraction isolation via ultracentrifugation is recommended, followed by solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin. A typical solubilization buffer might contain:

  • 50 mM Tris-HCl, pH 8.0

  • 150-300 mM NaCl

  • 1-2% detergent

  • 10% glycerol

  • Protease inhibitors

• Purification: His-tagged nuoK can be purified using immobilized metal affinity chromatography (IMAC) with Ni-NTA resin, followed by size exclusion chromatography. Maintaining detergent concentrations above critical micelle concentration throughout purification is essential to prevent protein aggregation .

• Storage: Purified protein should be stored in a buffer containing:

  • 20 mM Tris-HCl, pH 8.0

  • 150 mM NaCl

  • 0.03-0.05% detergent

  • 6% Trehalose

Aliquoting and storage at -80°C is recommended to prevent freeze-thaw cycles which may compromise protein integrity .

How can researchers verify successful expression and purification of recombinant nuoK?

Multiple analytical methods should be employed to confirm successful nuoK expression and purification:

• SDS-PAGE analysis: Use 12-15% gels to visualize the approximately 10-12 kDa band corresponding to nuoK, with purity assessment exceeding 90% .

• Western blotting: Anti-His antibodies can detect tagged nuoK protein, confirming identity.

• Mass spectrometry: LC-MS/MS analysis of tryptic digests to confirm protein identity through peptide mass fingerprinting.

• Circular dichroism spectroscopy: Assess secondary structure integrity, particularly important for verifying proper folding of membrane proteins.

• Activity assays: While challenging for individual subunits, functional reconstitution with other Complex I components can provide evidence of proper folding and assembly potential.

How can researchers assess the functional activity of recombinant nuoK in vitro?

Assessing the functional activity of an individual subunit like nuoK presents unique challenges since it normally functions as part of the larger Complex I. Researchers may employ several approaches:

• Reconstitution assays: Incorporate purified nuoK into proteoliposomes or nanodiscs along with other Complex I subunits to reconstruct a minimal functional unit. NADH oxidation activity can then be measured spectrophotometrically by monitoring NADH absorbance decrease at 340 nm.

• Proton translocation assays: Using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine) in reconstituted systems to detect proton movement across membranes.

• Binding assays: Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to assess interaction between nuoK and other Complex I subunits or quinone substrates.

• Complementation studies: Express recombinant nuoK in nuoK-deficient bacterial strains to determine if function is restored, as measured by growth rates or respiratory activity.

What antibody-based detection methods are suitable for B. avium nuoK in research applications?

For antibody-based detection of B. avium nuoK, researchers should consider:

• Primary antibodies: Due to the relatively small size and hydrophobic nature of nuoK, epitope selection is crucial. Custom antibodies raised against:

  • The N or C terminal regions (if exposed)

  • Synthetic peptides corresponding to predicted extramembrane loops

  • His-tag if using tagged recombinant protein

• Detection methods:

  • ELISA: For quantitative detection in purified samples or crude lysates

  • Western blotting: Using specialized protocols for membrane proteins, including careful SDS concentration and transfer conditions

  • Immunofluorescence: For localization studies, though cell permeabilization optimization is critical for accessing membrane-embedded epitopes

• Cross-reactivity considerations: Test antibodies against other Bordetella species, particularly B. petrii, to assess specificity. The high conservation in respiratory proteins may result in cross-reactivity .

How can researchers effectively use recombinant nuoK protein in structural studies?

Structural characterization of membrane proteins like nuoK presents significant challenges. Research approaches include:

• X-ray crystallography:

  • Detergent screening to identify conditions that maintain protein stability and promote crystal formation

  • Lipidic cubic phase crystallization as an alternative approach for membrane proteins

  • Consideration of fusion partners (e.g., T4 lysozyme) to increase soluble domains for crystal contacts

• Cryo-electron microscopy:

  • Single-particle analysis within detergent micelles or nanodiscs

  • Focused classification approaches to resolve the nuoK region within the larger Complex I

• Nuclear magnetic resonance (NMR):

  • Solution NMR for specific domains or fragments

  • Solid-state NMR for full-length protein in a membrane environment

  • Specific isotope labeling (15N, 13C) strategies for detailed structural insights

• Molecular dynamics simulations:

  • In silico modeling based on homologous structures, particularly from B. petrii nuoK

  • Validation through experimental constraints from limited proteolysis or chemical crosslinking

What is the significance of nuoK in B. avium pathogenesis and respiratory disease in turkeys?

B. avium is the etiologic agent of turkey coryza (bordetellosis), a respiratory disease responsible for substantial economic losses to the turkey industry . While the specific role of nuoK in pathogenesis is not directly established in the search results, its function as part of Complex I in the respiratory chain suggests several potential contributions to virulence:

• Energy metabolism: NuoK, as part of NADH-quinone oxidoreductase, likely contributes to efficient energy production required for bacterial growth and colonization in the respiratory tract.

• Adaptation to microenvironments: Respiratory complexes allow bacteria to adapt to varying oxygen levels and nutrient availability encountered during infection.

• Persistence: Efficient respiratory metabolism may support bacterial persistence in host tissues, particularly under stress conditions.

• Potential immunomodulation: Bacterial respiratory proteins can sometimes trigger host immune responses, potentially contributing to pathogenesis through inflammation.

Research on vaccine development against B. avium has focused on various preparations, including formalin-inactivated and acid-inactivated bacteria . The conservation of respiratory proteins like nuoK may make them potential targets for vaccine development, though specific studies targeting nuoK are not reported in the search results.

How does nuoK expression in B. avium compare under different growth conditions and within host environments?

Though specific data on nuoK expression patterns in B. avium are not provided in the search results, research approaches to address this question would include:

• Quantitative RT-PCR analysis of nuoK expression under various conditions:

  • Aerobic vs. microaerobic vs. anaerobic growth

  • Different carbon sources and nutrient limitations

  • Exposure to host-relevant stresses (temperature shifts, pH changes, oxidative stress)

  • During infection of respiratory epithelial cells

• Transcriptomic profiling:

  • RNA-Seq analysis comparing expression in laboratory media vs. in vivo samples

  • Identification of co-regulated genes that may form an operon with nuoK

  • Detection of regulatory elements controlling expression

• Protein expression analysis:

  • Western blotting or targeted proteomics to quantify nuoK protein levels

  • Correlation between transcriptional and translational regulation

Such analyses would provide insights into how B. avium modulates its energy metabolism during different stages of infection and in response to environmental changes.

How does B. avium nuoK compare to homologous proteins in other Bordetella species and respiratory pathogens?

Comparative analysis of nuoK across Bordetella species and other respiratory pathogens provides valuable evolutionary insights:

• Sequence conservation: While specific sequence alignments for nuoK are not provided in the search results, the high conservation observed in other B. avium genetic targets suggests nuoK likely shows significant conservation across Bordetella species . Analysis of amplicons from 72 B. avium strains collected over 25 years showed only three single-base polymorphisms in certain genetic targets, resulting in four unique sequence variants differing by one or two base substitutions .

• Structural comparison: The amino acid sequence of B. petrii nuoK (MTLTLAHYLVLGAILFAIGIFGIFLNRRNLIILLMSIELVLLAVNMNFVAFSSWFGDTAGQVFVFFILTVAAAEAAIGLAILVLLFRNLNTINVDELDRLKG) likely shares significant homology with B. avium nuoK . This sequence reveals the highly hydrophobic nature typical of transmembrane proteins in respiratory complexes.

• Functional conservation: The respiratory pathways analysis showed that ATP synthases of F- and/or V-type were found in all analyzed genomes, with variations observed in respiratory reductases and quinone biosynthesis . This suggests fundamental conservation of energy metabolism components with species-specific adaptations.

What methods are most effective for studying evolutionary relationships of nuoK across bacterial species?

For evolutionary analysis of nuoK across bacterial species, researchers should employ:

• Phylogenetic analysis approaches:

  • Maximum likelihood methods using programs such as RAxML or IQ-TREE

  • Bayesian inference approaches for tree construction

  • Appropriate models of amino acid substitution, particularly those designed for membrane proteins

• Selection pressure analysis:

  • Calculation of dN/dS ratios to identify sites under purifying or positive selection

  • Identification of specificity determining positions (SDPs) using specialized tools

• Structural comparison methods:

  • Homology modeling based on crystal structures of Complex I

  • Analysis of conserved residues in the context of three-dimensional structure

  • Identification of co-evolving residues that maintain protein-protein interactions within Complex I

• Genomic context analysis:

  • Examination of gene order conservation around nuoK

  • Analysis of operon structures across species

  • Identification of potential horizontal gene transfer events

The search results indicate that approaches combining sequence similarity, protein domain structure, specificity determining positions, and genome-context have been successfully applied to analyze respiratory components across bacterial species .

How can researchers utilize nuoK for molecular typing and identification of B. avium strains?

NuoK could potentially serve as a molecular target for typing and identification of B. avium strains, though the search results don't specifically address this application. Based on principles established for other molecular targets:

How might recombinant nuoK be utilized in B. avium vaccine development strategies?

Recombinant nuoK could potentially contribute to B. avium vaccine development through several approaches:

• Subunit vaccine development:

  • Recombinant nuoK alone or in combination with other B. avium antigens could be evaluated as subunit vaccines

  • The conservation of nuoK across strains would potentially provide broad protection

  • Expression systems similar to those used for B. petrii nuoK could be adapted for large-scale antigen production

• Adjuvant selection and formulation:

  • Current research on B. avium vaccines has examined non-adjuvated suspensions administered subcutaneously

  • For recombinant proteins like nuoK, adjuvant selection would be crucial to enhance immunogenicity

  • Evaluation of different preparation techniques, similar to those studied for whole-cell vaccines (formalin inactivation, opsonization, buffered acetic-acid inactivation)

• Immune response assessment:

  • Measurement of specific antibody titers by ELISA

  • Calculation of sample-to-positive (S/P) ratios to determine percentage of responders

  • Comparison of immune response kinetics at multiple time points post-vaccination (e.g., day 6, 10, 21)

While the effectiveness of nuoK as a vaccine candidate remains to be determined, research approaches should build upon established methodologies for B. avium vaccine evaluation, including assessment of antibody response titers and protection against challenge .

What are common challenges in recombinant expression of nuoK and how can they be addressed?

Researchers working with recombinant nuoK may encounter several technical challenges:

• Low expression levels:

  • Optimize codon usage for expression host

  • Test different promoter systems (T7, tac, araBAD)

  • Evaluate expression at lower temperatures (16-20°C)

  • Consider fusion partners to enhance solubility (MBP, SUMO)

• Protein toxicity to expression host:

  • Use tightly regulated expression systems

  • Employ bacterial strains designed for toxic protein expression (C41/C43)

  • Test auto-induction media for gentler expression

  • Consider cell-free expression systems

• Inclusion body formation:

  • Modify extraction buffers with mild detergents

  • Optimize membrane protein solubilization conditions

  • Explore different detergents for solubilization

  • Establish protocols for refolding from inclusion bodies if necessary

• Protein degradation:

  • Include protease inhibitors during purification

  • Optimize buffer conditions (pH, salt concentration)

  • Test different E. coli strains lacking specific proteases

  • Process samples at 4°C and minimize handling time

• Poor yield after purification:

  • Optimize purification conditions based on the 90% purity standard achieved for similar proteins

  • Consider batch purification rather than column for initial capture

  • Explore different detergents or detergent concentrations

  • Test various elution conditions for affinity chromatography

What methods are available for assessing the integrity and activity of purified recombinant nuoK?

Assessment of integrity and activity for purified recombinant nuoK requires multiple complementary approaches:

• Physical integrity assessment:

  • SDS-PAGE with appropriate gel percentage (15-20%) for small membrane proteins

  • Native PAGE to evaluate oligomeric state

  • Size exclusion chromatography to assess aggregation state

  • Dynamic light scattering for homogeneity analysis

• Structural integrity:

  • Circular dichroism spectroscopy to evaluate secondary structure

  • Fluorescence spectroscopy to assess tertiary structure

  • Thermal shift assays to determine stability under various conditions

  • Limited proteolysis to probe for correctly folded conformations

• Functional assessment:

  • Reconstitution into liposomes with other Complex I components

  • NADH oxidation assays in reconstituted systems

  • Proton pumping assays using pH-sensitive fluorescent dyes

  • Binding assays with known interaction partners from Complex I

• Storage stability:

  • Monitor protein stability over time under recommended storage conditions

  • Assess effects of freeze-thaw cycles

  • Evaluate protective effects of additives like trehalose (6%) as used for similar proteins

  • Test stability at different temperatures (-20°C vs. -80°C)

Maintaining protein quality above 90% purity, as achieved with similar proteins , should be the standard for recombinant nuoK preparations used in research applications.