Recombinant Bordetella avium Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Prolipoprotein Diacylglyceryl Transferase (Lgt)

Prolipoprotein diacylglyceryl transferase (Lgt) is a membrane-bound enzyme critical for bacterial lipoprotein biosynthesis. It catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the cysteine residue of prolipoproteins, forming a thioether bond essential for lipoprotein maturation . In Bordetella avium, Lgt is hypothesized to play a role in virulence by modifying lipoproteins involved in host-pathogen interactions, though direct studies on the recombinant form remain limited.

Functional Role in Lipoprotein Biosynthesis

Lgt initiates a three-step lipoprotein maturation pathway:

  1. Diacylglyceryl transfer: Lgt attaches diacylglycerol to prolipoproteins.

  2. Signal peptide cleavage: By signal peptidase II (Lsp).

  3. N-acylation: By apolipoprotein N-acyltransferase (Lnt) in select bacteria .
    In B. avium, this process likely underpins outer membrane protein localization, as seen in its 21K and 37K surface-exposed lipoproteins .

Recombinant Production and Applications

While recombinant B. avium Lgt has not been explicitly documented, B. pertussis Lgt is produced in E. coli for vaccine development . Potential applications for B. avium Lgt include:

  • Vaccine antigen: Surface-exposed lipoproteins modified by Lgt are immunogenic targets .

  • Antimicrobial target: Essentiality of Lgt for bacterial growth makes it a drug candidate .

  • Diagnostic tool: ELISA assays using recombinant Lgt could detect B. avium antibodies .

Research Gaps and Future Directions

Current limitations include:

  • No structural or kinetic data for B. avium Lgt.

  • Lack of direct evidence for its role in virulence.

  • Underexplored potential in diagnostic or therapeutic contexts.

Future studies should prioritize heterologous expression, enzymology, and immunological profiling of recombinant B. avium Lgt to address these gaps.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lgt; BAV2897; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Bordetella avium (strain 197N)
Target Names
lgt
Target Protein Sequence
MLQFPQFDPVALRLGPLAIHWYGLMYLLAFAFVYLLGRYRIKRGQGGNLTYKDLEDLIFY SVLGVVLGGRLGYVLFYKPGYYLSHPLEIAFLWEGGMSFHGGLIGVILVMLLFARKKGVS FFTISDFIAPLIPLGLGAGRLGNFINGELWGRPSDLPWAMVFPQSGSMLPRHPSQLYELG LEGLVLFALLWWFSSKPRPSGQVSAMFLMGYGAFRFLVEFTREPDNFLGLLAGGMSMGQW LSLPMFLGGLVLFVLTARRSSRQP
Uniprot No.

Target Background

Function

Recombinant Bordetella avium Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links

KEGG: bav:BAV2897

STRING: 360910.BAV2897

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.