Recombinant Bordetella bronchiseptica ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag.
Synonyms
atpB; BB4611; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)
Target Names
atpB
Target Protein Sequence
MAAPSGASPQSEYIQHHLVHLNNIGEKQSVIAQFNVINYDSLFWSILMGLLVVFCLWLAA RRATAGVPGRFQGFIEMIVDMVDDQAKSIVTNAKSRLFVAPLALTVFLWIILMNALDLLP VDLLPSIWRMTGLGAEHGDPLYYHRILPTADLNVPMGMSLGVLLLMFYYGIKIKHPGGFV KELFTAPFHAHGLASLVLAPFNLLLNLIEYAAKSVSLGMRLFGNMFAGELIFMLIALLGG AWTGFNGASIGLGIGHVLAGSVWAIFHILIVLLQAFIFMMLTLVYIGQAHEGH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: bbr:BB4611

STRING: 257310.BB4611

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ATP synthase subunit a (atpB) in Bordetella bronchiseptica?

ATP synthase subunit a (atpB) in Bordetella bronchiseptica is a critical component of the F0 sector of ATP synthase complex, which is responsible for proton translocation across the bacterial membrane during oxidative phosphorylation. This membrane-embedded protein forms a proton channel that converts the energy of the proton gradient into mechanical energy, which is then used by the F1 sector to synthesize ATP. In B. bronchiseptica, the atpB protein (UniProt accession: Q7WEM3) consists of 293 amino acids that form transmembrane helices essential for proton conduction . The functionality of this protein is crucial for energy metabolism in this pathogen, which requires efficient ATP production to sustain virulence and colonization in the host respiratory tract.

How does recombinant atpB differ from native atpB in structural and functional studies?

Recombinantly produced atpB may exhibit subtle differences from its native counterpart, primarily due to expression system variations and post-translational modifications. When expressed in heterologous systems (such as E. coli), recombinant atpB typically contains additional elements such as affinity tags that facilitate purification but may influence protein folding or oligomerization behavior. Unlike some ATP synthase subunits that require oligomerization for biological activity (as seen with ATP synthase subunit β, which forms functional trimers), atpB's functional characteristics are primarily dependent on its correct membrane integration and interaction with other F0 components . Researchers should be aware that recombinant atpB produced outside the context of the complete ATP synthase complex may display altered biophysical properties compared to the native protein.

What are the optimal storage and handling conditions for recombinant Bordetella bronchiseptica atpB?

Based on established protocols for similar recombinant proteins, optimal storage conditions for recombinant B. bronchiseptica atpB include maintaining the protein in Tris-based buffer with 50% glycerol at -20°C for routine usage . For long-term preservation, storage at -80°C is recommended to minimize protein degradation and maintain structural integrity. When working with the protein, it's advisable to avoid repeated freeze-thaw cycles, instead preparing small working aliquots stored at 4°C for up to one week. The protein should be maintained in a stabilizing buffer optimized for this specific recombinant protein to prevent aggregation or denaturation . Researchers should validate protein stability using techniques such as SDS-PAGE or functional assays after storage to ensure experimental reproducibility.

What are the recommended expression systems for producing high-quality recombinant B. bronchiseptica atpB?

The selection of an appropriate expression system is crucial for obtaining functionally active recombinant Bordetella bronchiseptica atpB. While E. coli remains the most commonly used host for initial expression attempts due to its rapid growth and high protein yields, membrane proteins like atpB often present challenges in this system. Based on protocols established for similar bacterial membrane proteins, researchers should consider the following expression systems and conditions:

Expression SystemAdvantagesChallengesRecommended Vectors
E. coli BL21(DE3)High yield, economicalInclusion body formationpET series with C-terminal His-tag
E. coli C41/C43Specialized for membrane proteinsLower yieldspET or pBAD vectors
Yeast (P. pastoris)Better folding of complex proteinsLonger production timepPICZ vectors
Baculovirus systemsNear-native foldingTechnical complexityBacmid constructs

Regardless of the chosen system, expression of atpB should include optimization of induction conditions, temperature modulation (typically 16-25°C for membrane proteins), and inclusion of stabilizing agents in the lysis buffer . Expression constructs should ideally include a removable affinity tag to facilitate purification while allowing subsequent tag removal for functional studies.

What purification strategies yield the highest purity and activity of recombinant atpB?

Purification of recombinant atpB presents considerable challenges due to its hydrophobic nature and membrane association. A multi-step purification approach is recommended for achieving high purity and maintaining functional integrity. The purification protocol should begin with membrane fraction isolation through differential centrifugation, followed by solubilization using appropriate detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations above their critical micelle concentration .

For affinity purification, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective when the recombinant atpB contains a histidine tag. Subsequent purification steps should include ion exchange chromatography to remove contaminants with different charge properties, followed by size exclusion chromatography to achieve final polishing and removal of protein aggregates. Throughout purification, it's crucial to maintain the protein in a stabilizing buffer containing appropriate detergents and potentially lipids to preserve the native conformation and activity. Protein purity should be assessed by SDS-PAGE, and functional integrity can be evaluated through reconstitution experiments or binding assays with other ATP synthase components.

What experimental approaches can verify the correct folding and functionality of recombinant atpB?

Verification of proper folding and functionality of recombinant atpB requires a combination of biophysical and functional analyses. Researchers should implement the following complementary approaches:

  • Circular Dichroism (CD) Spectroscopy: CD analysis in the far-UV range (190-250 nm) can confirm the presence of expected secondary structural elements, particularly the alpha-helical content characteristic of atpB.

  • Limited Proteolysis: Correctly folded proteins exhibit distinctive proteolytic patterns compared to misfolded variants. Time-course proteolysis with enzymes like trypsin can provide insights into structural integrity.

  • Thermal Shift Assays: These can determine protein stability and identify buffer conditions that optimize proper folding.

  • Reconstitution Studies: Incorporation of purified atpB into liposomes or nanodiscs followed by assessment of proton translocation activity provides direct evidence of functionality.

  • Interaction Analysis: Co-immunoprecipitation or surface plasmon resonance studies with other ATP synthase components (particularly subunits b and c) can confirm proper structural conformation required for these essential interactions .

  • Cross-linking Experiments: Chemical cross-linking followed by mass spectrometry analysis can verify that atpB assumes its native structural arrangement and interacts appropriately with partner proteins.

These complementary approaches provide a comprehensive assessment of the recombinant protein's structural and functional integrity before proceeding with more sophisticated applications.

How can recombinant B. bronchiseptica atpB be utilized for studying antimicrobial resistance mechanisms?

Recombinant atpB serves as a valuable tool for investigating antimicrobial resistance mechanisms in Bordetella bronchiseptica, particularly those involving energy metabolism. While B. bronchiseptica typically harbors the β-lactamase gene blaBOR and sulfonamide resistance gene sul2, the ATP synthase complex represents an underexplored target for novel antimicrobial development . Researchers can utilize recombinant atpB in the following experimental approaches:

  • Drug-Target Interaction Studies: Binding assays between recombinant atpB and known ATP synthase inhibitors (such as bedaquiline analogues) can reveal structure-activity relationships and resistance mechanisms specific to Bordetella species.

  • Site-Directed Mutagenesis: Introduction of specific mutations in recombinant atpB, particularly in residues forming the proton channel, allows investigation of how structural modifications affect inhibitor sensitivity. This approach helps identify potential resistance mutations before they emerge clinically.

  • Comparative Studies: Parallel analysis of atpB from susceptible and resistant isolates can identify natural variations that contribute to differential drug sensitivity. This is particularly relevant given the observed genetic diversity among B. bronchiseptica isolates from different hosts .

  • Heterologous Expression: Introduction of recombinant B. bronchiseptica atpB into model organisms lacking endogenous ATP synthase activity can determine whether this protein confers altered susceptibility to specific antimicrobial agents.

These approaches collectively provide insights into potential mechanisms of resistance involving the ATP synthase complex, which may guide the development of novel therapeutic strategies against B. bronchiseptica infections.

What role does atpB play in B. bronchiseptica virulence and host adaptation?

ATP synthase subunit a (atpB) plays a significant though indirect role in B. bronchiseptica virulence and host adaptation primarily through its central function in energy metabolism. As the pathogen transitions between environments—from external conditions to the host respiratory tract—it must modulate energy production to adapt to available nutrients and oxygen levels. The atpB protein, as a key component of ATP synthase, facilitates this metabolic flexibility.

Research approaches to investigate this relationship include:

  • Conditional Knockdown Studies: Since complete deletion of atpB would likely be lethal, conditional expression systems allow for the controlled reduction of atpB levels, revealing how diminished ATP synthase activity affects expression of virulence factors such as adhesins and toxins.

  • Transcriptional Analysis: Comparing atpB expression levels during different growth conditions (nutrient limitation, various pH levels, biofilm formation) can reveal how energy metabolism is regulated during host colonization.

  • Proteomic Interaction Studies: Identification of proteins that interact with atpB beyond the ATP synthase complex may uncover unexpected connections between energy metabolism and virulence regulatory networks.

  • Host-Pathogen Interface Experiments: Analyzing atpB expression during interaction with host epithelial cells or immune components can provide insights into how B. bronchiseptica adapts its energy metabolism during infection .

Preliminary studies with other respiratory pathogens suggest that ATP synthase components may serve as molecular targets recognized by host immune factors, positioning atpB as a potential interface molecule in host-pathogen interactions beyond its metabolic function.

What insights can structural studies of recombinant atpB provide for drug development?

Structural studies of recombinant B. bronchiseptica atpB offer significant potential for rational drug design targeting this respiratory pathogen. The membrane-embedded nature of atpB presents both challenges and opportunities for structure determination and drug development.

For effective structural characterization, researchers should consider:

  • Cryo-Electron Microscopy: This approach is particularly suitable for membrane proteins like atpB, especially when studied in the context of the complete ATP synthase complex. Recent advances in single-particle analysis have made it possible to achieve near-atomic resolution of membrane protein structures.

  • X-ray Crystallography: While challenging for isolated atpB, this method has been successful for ATP synthase components when stabilized with antibody fragments or incorporated into lipidic cubic phases.

  • Solid-State NMR: This emerging technique can provide valuable information about dynamics and conformational changes of atpB within a membrane environment.

Drug development applications include:

  • Identification of Unique Binding Pockets: Structural data can reveal Bordetella-specific features in atpB that differ from host ATP synthase, enabling selective targeting.

  • Structure-Based Virtual Screening: Computational screening against resolved atpB structures can identify novel chemical scaffolds with inhibitory potential.

  • Fragment-Based Drug Design: This approach can leverage structural information about atpB to develop compounds that specifically disrupt its function or assembly with other ATP synthase components.

  • Allosteric Inhibitor Development: Structural studies may reveal non-catalytic sites where binding of small molecules could disrupt essential conformational changes in atpB during ATP synthesis.

The significant sequence conservation of atpB within the Bordetella genus suggests that drugs targeting this protein could potentially have broad applicability against related pathogens like B. pertussis, the causative agent of whooping cough .

How does B. bronchiseptica atpB compare structurally and functionally to homologous proteins in other bacterial pathogens?

Comparative analysis of B. bronchiseptica atpB with homologous proteins in other bacterial pathogens reveals both conserved features essential for ATP synthase function and species-specific adaptations. Based on sequence analysis and predicted structural models:

OrganismSequence Identity to B. bronchiseptica atpBNotable Structural DifferencesFunctional Implications
B. pertussis>95%Nearly identical structureSimilar drug susceptibility profile expected
B. parapertussis~93%Minor variations in transmembrane helicesPotentially altered proton conductance
E. coli~70%Differences in cytoplasmic loop regionsDifferent regulatory interactions
Mycobacterium tuberculosis~45%Significant variations in proton channel residuesDifferent bedaquiline sensitivity
Helicobacter pylori~40%Altered c-ring interaction interfaceAdapted to function at acidic pH

These comparative differences may explain the varied sensitivity of these organisms to ATP synthase inhibitors and provide valuable insights for developing species-specific antimicrobials. Unlike the ATP synthase β subunit, which has been shown to form IL-1β binding trimeric assemblies in some bacteria (as seen in study ), the atpB subunit primarily functions within the membrane-embedded F0 sector without known immune evasion roles. Understanding these structural and functional differences is essential for developing targeted therapeutic approaches for different bacterial pathogens.

What technical challenges exist in studying interactions between atpB and other ATP synthase components?

Investigating interactions between atpB and other ATP synthase components presents several significant technical challenges that researchers must address:

  • Membrane Protein Reconstitution: The hydrophobic nature of atpB and many interacting partners requires careful selection of detergents and lipids that maintain native protein-protein interactions while allowing experimental manipulation.

  • Complex Assembly Dynamics: The ATP synthase complex assembles in a specific temporal sequence; recreating this process in vitro requires controlled addition of components and appropriate environmental conditions.

  • Capturing Transient Interactions: Many interactions within the ATP synthase complex are dynamic and state-dependent, necessitating techniques that can capture these transient associations.

  • Distinguishing Direct from Indirect Interactions: Within the densely packed ATP synthase complex, distinguishing direct from proximity-based interactions requires specialized approaches like site-specific cross-linking or FRET analysis.

Recommended methodological approaches include:

  • Nanodisc Technology: Incorporating atpB into nanodiscs provides a more native-like membrane environment for interaction studies than traditional detergent micelles.

  • Site-Specific Crosslinking: Introduction of photo-activatable amino acids at defined positions in atpB can help map interaction interfaces with unprecedented precision.

  • Single-Molecule FRET: This technique can reveal dynamic interactions between fluorescently labeled atpB and other subunits during functional cycles.

  • Mass Spectrometry of Intact Complexes: Native mass spectrometry can determine stoichiometry and composition of assembled complexes containing atpB.

  • Genetic Complementation Systems: Bacterial strains with conditional atpB expression can be used to test functional complementation by engineered variants, revealing residues critical for proper complex assembly.

These approaches collectively address the challenges inherent in studying membrane protein interactions and provide comprehensive insights into atpB's role within the ATP synthase complex.

How do genetic variations in atpB across different B. bronchiseptica strains correlate with phenotypic differences?

Genetic variation in atpB among B. bronchiseptica strains can significantly impact phenotypic characteristics including growth rates, energy efficiency, and potentially host adaptation. While whole genome sequencing studies have identified considerable genomic conservation among B. bronchiseptica isolates, subtle variations in metabolic genes like atpB may contribute to observed phenotypic diversity .

Approaches for investigating genotype-phenotype correlations include:

  • Comparative Genomics: Analyzing atpB sequences across B. bronchiseptica isolates from different hosts and geographic regions can identify positively selected residues that may reflect adaptation to specific niches.

  • Allelic Exchange Experiments: Replacing the native atpB in a reference strain with variants from isolates displaying distinct phenotypes can directly test the contribution of atpB polymorphisms to observed differences.

  • Metabolic Flux Analysis: Measuring ATP production rates and proton pumping efficiency in strains with different atpB variants can quantify the functional impact of genetic variations.

  • Host Adaptation Studies: Comparing atpB sequences from B. bronchiseptica strains isolated from different host species (e.g., swine, dogs, humans) may reveal host-specific adaptations in energy metabolism.

Research with other respiratory pathogens suggests that even minor variations in ATP synthase components can affect growth rates under nutrient limitation and contribute to differential survival under stress conditions. This understanding is particularly relevant given the broad host range of B. bronchiseptica compared to other Bordetella species, possibly reflecting adaptive metabolic flexibility mediated in part through variations in energy-generating systems .

What potential exists for atpB as a diagnostic or vaccine target for B. bronchiseptica infections?

The potential of atpB as a diagnostic or vaccine target for B. bronchiseptica infections warrants careful consideration. While ATP synthase components are typically not primary vaccine candidates due to their high conservation across species and limited surface exposure, several unique attributes of atpB may make it valuable in certain diagnostic or immunological applications:

For diagnostic development:

  • Serological Detection: Highly purified recombinant atpB could serve as an antigen in ELISA-based assays to detect B. bronchiseptica-specific antibodies, particularly if species-specific epitopes can be identified.

  • Molecular Diagnostics: Primers targeting polymorphic regions of the atpB gene may enable sensitive and specific PCR-based detection and differentiation of Bordetella species in clinical samples.

  • Biosensor Applications: Immobilized recombinant atpB with intact conformational epitopes could be utilized in surface plasmon resonance or similar technologies for rapid pathogen detection.

For vaccine development considerations:

  • Subunit Vaccine Component: While complete atpB protein is largely membrane-embedded, specific extracellular loops might present B. bronchiseptica-specific epitopes suitable for inclusion in subunit vaccines.

  • Carrier Protein Applications: The stable structure of recombinant atpB might make it useful as a carrier protein for conjugation to polysaccharide antigens, potentially enhancing immunogenicity.

  • DNA Vaccine Approaches: Including the atpB gene in DNA vaccine constructs could potentially generate cell-mediated immune responses against infected cells expressing this protein.

Researchers should note that unlike proteins like pertactin or filamentous hemagglutinin, atpB has not been established as an immunodominant antigen in natural infection. Therefore, its utility as a standalone vaccine antigen may be limited but could complement existing vaccine formulations or diagnostic platforms .

How can systems biology approaches incorporate atpB function to better understand B. bronchiseptica pathogenesis?

Systems biology approaches offer powerful frameworks for integrating atpB function into comprehensive models of B. bronchiseptica pathogenesis. These holistic strategies can reveal how energy metabolism interfaces with virulence networks during host infection:

  • Multi-omics Integration: Combining transcriptomics, proteomics, and metabolomics data from B. bronchiseptica under various conditions can position atpB within regulatory networks that respond to environmental changes during infection. This approach can reveal how ATP synthase activity influences expression of virulence factors through metabolic signaling.

  • Flux Balance Analysis: Mathematical modeling of B. bronchiseptica metabolism with variable atpB expression can predict how energy production constraints impact various virulence-associated pathways. This approach can generate testable hypotheses about metabolic bottlenecks during different infection phases.

  • Host-Pathogen Interaction Networks: Incorporating host factors that interact with bacterial ATP synthase components can reveal unexpected immunomodulatory functions. For instance, research with other pathogens has shown that ATP synthase components may interact with host immune proteins, similar to how ATP synthase subunit β can bind to IL-1β .

  • Predictive Virulence Modeling: Developing computational models that incorporate ATP production efficiency as a variable can help predict how metabolic adaptations influence colonization potential and persistence in different host environments.

  • Comparative Systems Analysis: Cross-species comparison of ATP synthase regulation and function between B. bronchiseptica and related pathogens like B. pertussis can reveal how metabolic specialization contributes to host specificity.

These systems approaches extend beyond traditional reductionist methods by revealing emergent properties of the bacterial pathogen that cannot be discerned from studying individual components in isolation. For B. bronchiseptica, which must adapt to diverse environments during transmission and infection, understanding the integration of energy metabolism with virulence expression is particularly relevant .

What emerging technologies will advance our understanding of atpB structure-function relationships?

Emerging technologies are poised to revolutionize our understanding of atpB structure-function relationships, offering unprecedented insights at molecular and atomic levels:

  • Cryo-Electron Tomography: This technique allows visualization of ATP synthase complexes directly within bacterial membranes, providing native structural context impossible to achieve with traditional structural biology approaches. For atpB, this means observing its orientation and interactions within intact B. bronchiseptica cells.

  • Single-Molecule Force Spectroscopy: These methods can directly measure the mechanical forces involved in conformational changes within atpB during proton translocation, providing unprecedented insights into energy conversion mechanisms.

  • Time-Resolved Serial Crystallography: Using X-ray free-electron lasers (XFELs), researchers can potentially capture transient conformational states of atpB during the catalytic cycle at subnanosecond time resolution.

  • Integrative Structural Biology: Combining data from multiple structural techniques (X-ray crystallography, cryo-EM, solid-state NMR, mass spectrometry) with computational modeling can overcome limitations of individual methods to produce complete structural models of atpB in different functional states.

  • AlphaFold and Related AI Approaches: Deep learning methods for protein structure prediction are rapidly improving and may soon enable accurate modeling of membrane proteins like atpB, particularly when integrated with sparse experimental constraints.

  • Nanopore Recording Technology: Reconstituting atpB into artificial membranes for electrical recording can provide direct measurements of proton conductance through individual channels, allowing correlation between structure and function at unprecedented resolution.

These technologies collectively promise to transform our understanding of how atpB's structure enables its essential functions in energy transduction, potentially revealing unique features that could be exploited for targeted therapeutic development against B. bronchiseptica infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.