Recombinant Bordetella bronchiseptica Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type selection occurs during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
msbA; BB3390; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-623
Protein Length
full length protein
Species
Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)
Target Names
msbA
Target Protein Sequence
MLAWRPGRPDGCRAAGGRRYNPGHDCIKASVSLNSAARNAPAGSQPVKAELWKRVYSRVG SYWKGLVLAVLLMAGAAATQPTLAVIMKPLLDDGFSGAKPHYVWFLPLAVVGLILLRGIC NFFSDYLLAWVANNVLRGIRGEMFERLLGLPDADFKRGDTGRLLNRFTIDAGNVTGYATD VITVLVRETLVVIALIGVLLYMSWALTLIILVMLPVSVGIARAFTRRLRRINRETVNMNA ELTRVVSEGIDGQRVIKLFDGYDAERRRFDFVNSRLRRFAMRSATADAALTPLTQVCISV AVGAVIAVALSQANSGALTVGSFASFMAALAQIFDPIKRLTNLAGKMQKMLVAAESVFTL VDQTPEADAGTRALPEPVRGKVEFRAVSHRFPDADRDTVSAVSFLVEPGQTVALVGRSGS GKTTLVNMLPRFVLPDGGDILFDDVPIQDLTLRSLRSHLSLVSQDVVLFDDTIAANVGYG AGGTVDDARVRDALAAANLLEFVDGLPLGIHTPVGQNAARLSGGQRQRLAIARALIKNAP VLILDEATSALDNESERQVQASLERLMRGRTTLVIAHRLSTVQNADRIIVLDAGKIVEHG PHSELLAANGLYASLYNMQFRED
Uniprot No.

Target Background

Function
This protein plays a critical role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore within the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: bbr:BB3390

STRING: 257310.BB3390

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MsbA protein and what is its significance in bacterial physiology?

MsbA is an essential ATP-binding cassette (ABC) transporter located in the inner membrane of Gram-negative bacteria, including Bordetella bronchiseptica. It functions as a floppase for lipopolysaccharide (LPS) precursor core-LPS, playing a critical role in the biogenesis of the bacterial outer membrane. As an essential protein for bacterial membrane integrity, MsbA has become a target for developing novel antibiotics. The protein exhibits high similarity to eukaryotic ABC transporters and serves as a model for multidrug efflux pumps, making it a paradigm for research in the ABC transporter field .

MsbA specifically transports lipid A across the inner membranes of Gram-negative bacteria, a process vital to bacterial viability. The protein flips newly synthesized core-lipid A to the outer surface of the inner membrane, facilitating proper membrane assembly and function . Inhibition of MsbA function results in significant alterations to bacterial membrane composition and integrity, ultimately affecting bacterial survival .

How does recombinant MsbA differ from native MsbA in terms of research applications?

Recombinant MsbA, particularly with affinity tags such as His-tags, offers several advantages for research applications compared to native MsbA. The recombinant protein allows for simplified purification using affinity chromatography, higher yield production, and the ability to introduce specific mutations for functional studies .

When working with recombinant MsbA, researchers should consider:

  • Expression system selection: E. coli is commonly used for full-length MsbA expression, providing proper folding of this bacterial membrane protein .

  • Storage conditions: Recombinant MsbA is typically stored in Tris-based buffer with 50% glycerol or similar stabilizing agents to maintain protein integrity during storage at -20°C/-80°C .

  • Handling considerations: Repeated freeze-thaw cycles should be avoided, and working aliquots are best stored at 4°C for up to one week .

  • Reconstitution protocols: The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage .

What are the optimal conditions for expression and purification of recombinant Bordetella bronchiseptica MsbA?

For optimal expression and purification of recombinant Bordetella bronchiseptica MsbA, researchers should consider the following protocol based on successful approaches with homologous proteins:

Expression System:

  • E. coli is the preferred expression system for full-length MsbA proteins due to its ability to properly fold bacterial membrane proteins .

  • Expression vectors should include an appropriate affinity tag (commonly His-tag) for purification purposes .

Culture Conditions:

  • Growth temperature: 28-30°C after induction typically yields better results for membrane proteins than standard 37°C

  • Induction: Low IPTG concentrations (0.1-0.5 mM) with extended expression time (16-20 hours)

  • Media supplementation: Addition of 5-10% glycerol can enhance membrane protein stability

Purification Protocol:

  • Cell lysis: Using detergent-based methods (e.g., n-dodecyl-β-D-maltoside) to solubilize membrane proteins

  • Affinity chromatography: Ni-NTA for His-tagged proteins

  • Size exclusion chromatography: For higher purity requirements

  • Buffer composition: Tris-based buffer containing stabilizing agents such as glycerol (up to 50%)

Quality Control:

  • Purity assessment: >90% as determined by SDS-PAGE

  • Functional verification: ATP hydrolysis assay to confirm enzymatic activity

What methodological approaches are most effective for studying MsbA structure-function relationships?

Multiple complementary approaches have proven effective for investigating structure-function relationships in MsbA proteins:

Spectroscopic Methods:

  • Site-directed spin labeling electron paramagnetic resonance (SDSL-EPR) spectroscopy: This technique has been successfully employed to analyze the local dynamics of specific residues within the conserved ABC motifs of MsbA, providing insights into motional and accessibility parameters during ATP binding and hydrolysis cycles .

  • Solid-state NMR spectroscopy: Allows for analysis of conformational changes in membrane-embedded MsbA without the need for crystallization .

Structural Biology Techniques:

  • X-ray crystallography: Has yielded structures of MsbA homodimers, although sometimes at relatively low resolution (4.2-4.5 Å) .

  • Cryo-EM: Recent advancements have improved resolution and revealed multiple conformational states of ABC transporters like MsbA .

Functional Assays:

  • In vivo growth assays: Complementation studies with temperature-sensitive MsbA mutants to assess functional significance of specific residues .

  • ATP hydrolysis assays: Biochemical assessment of ATPase activity to correlate structural features with function .

  • Lipid transport assays: Fluorescence-based methods to directly measure transport function.

Mutational Analysis:

  • Site-directed mutagenesis targeting conserved motifs: Particularly effective for analyzing the Walker A, Walker B, and signature motifs crucial for ATP binding and hydrolysis .

  • Temperature-sensitive mutants: Creation of conditional mutants (e.g., the A270T substitution in E. coli MsbA) allows for controlled inactivation and subsequent analysis of membrane lipid transport .

A comprehensive approach combining these methodologies provides the most robust understanding of MsbA structure-function relationships.

How can researchers effectively reconstitute MsbA into liposomes for functional studies?

Reconstitution of MsbA into liposomes is critical for functional studies as it provides a native-like membrane environment. An effective protocol should include:

Materials Required:

  • Purified recombinant MsbA protein (>90% purity)

  • Phospholipids (typically E. coli polar lipid extract or defined mixtures of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin)

  • Detergent (n-dodecyl-β-D-maltoside or Triton X-100)

  • Bio-Beads SM-2 or equivalent for detergent removal

Reconstitution Protocol:

  • Prepare lipid mixture in chloroform and dry under nitrogen gas

  • Hydrate the lipid film with buffer and sonicate to form liposomes

  • Solubilize liposomes with detergent

  • Add purified MsbA at the desired lipid:protein ratio (typically 100:1 to 200:1)

  • Remove detergent by adding Bio-Beads in a stepwise manner (4-6 hours at 4°C)

  • Collect proteoliposomes by ultracentrifugation

  • Resuspend in appropriate buffer for functional assays

Verification of Successful Reconstitution:

  • Freeze-fracture electron microscopy to visualize protein incorporation

  • Sucrose density gradient centrifugation to confirm protein-liposome association

  • ATP hydrolysis assays to verify retained functionality

Functional Assays with Reconstituted MsbA:

  • ATP hydrolysis measurements using malachite green or radioactive ATP

  • Transport assays using fluorescent lipid analogs

  • Assessment of conformational changes using spectroscopic techniques

This approach provides a controlled system for analyzing MsbA function in a membrane environment that mimics its native state.

How does the ATP binding and hydrolysis mechanism in MsbA compare across different bacterial species?

The ATP binding and hydrolysis mechanism in MsbA shows both conservation and species-specific variations across different bacteria:

Conserved Elements:

  • Walker A motif (GXXGXGKS/T): Essential for ATP binding through interactions with the phosphate groups of ATP

  • Walker B motif (hhhhDE, where h is a hydrophobic residue): Critical for ATP hydrolysis by coordinating Mg²⁺ and activating a water molecule for nucleophilic attack

  • Signature motif (LSGGQ): Characteristic of ABC transporters, participating in ATP binding and hydrolysis through inter-domain interactions

Species-Specific Variations:
The comparison of key functional residues reveals subtle differences that may impact ATP hydrolysis efficiency:

SpeciesWalker AWalker BSignature MotifNotes on Variation
Bordetella bronchisepticaGKTTLVNMLFDDVPILSGGQRQRHigher sequence similarity to mammalian P-glycoprotein
Escherichia coliGKSTLVNLILDEATSLSGGQRQRExtensively studied model; temperature-sensitive mutant A270T affects transport function
Blochmannia floridanusGKSTIVNLLDEATSSLDTLSGGQRQRContains extended Walker B region

Functional studies using site-directed spin labeling EPR spectroscopy have revealed that despite sequence conservation, the local dynamics of specific residues within these motifs can vary between species, affecting ATP turnover rates and coupling efficiency to substrate transport . These differences may reflect adaptations to specific bacterial membrane environments and lipid A structures.

What role does MsbA play in antibiotic resistance, and how can this inform drug development strategies?

MsbA's role in antibiotic resistance and as a drug target involves several key mechanisms:

Contribution to Antibiotic Resistance:

  • Essential role in LPS transport: As a floppase for lipopolysaccharide precursors, MsbA is critical for outer membrane biogenesis, which forms a permeability barrier against many antibiotics .

  • Structural similarity to multidrug efflux pumps: MsbA shares high similarity with eukaryotic ABC transporters involved in multidrug resistance .

  • Potential broad substrate specificity: Beyond its primary role in lipid A transport, MsbA may directly contribute to the efflux of certain antimicrobial compounds.

Drug Development Strategies:

  • Direct MsbA inhibition approach:

    • Target the ATPase domain: Compounds that interfere with ATP binding or hydrolysis

    • Target the transmembrane domains: Molecules that block the substrate binding pocket or prevent conformational changes

    • Target the interdomain communication: Compounds that disrupt coupling between ATP hydrolysis and substrate translocation

  • Allosteric modulation strategy:

    • Identify allosteric sites that can lock MsbA in specific conformations

    • Develop compounds that interfere with homodimerization

  • Bacterial specificity considerations:

    • Focus on structural differences between bacterial MsbA and human ABC transporters

    • Exploit species-specific variations in the substrate binding pocket

Experimental Approaches for Drug Discovery:

  • High-throughput screening against purified MsbA

  • Structure-based virtual screening using refined MsbA models

  • Fragment-based drug discovery targeting specific functional sites

  • Phenotypic screening using temperature-sensitive MsbA mutants

MsbA's essential nature and its role in membrane biogenesis make it an attractive antibiotic target, though care must be taken to achieve bacterial specificity while avoiding toxicity to human ABC transporters .

How can advanced spectroscopic techniques be applied to study conformational changes in MsbA during its transport cycle?

Advanced spectroscopic techniques provide powerful tools for investigating the dynamic conformational changes that occur during the MsbA transport cycle:

Site-Directed Spin Labeling EPR Spectroscopy:
This technique has proven particularly valuable for studying MsbA dynamics . The approach involves:

  • Strategic introduction of cysteine residues at positions of interest

  • Labeling with nitroxide spin labels

  • EPR spectroscopy to analyze:

    • Local dynamics through motional analysis

    • Solvent accessibility through collision frequency with paramagnetic reagents

    • Distance measurements between labeled sites using DEER (Double Electron-Electron Resonance)

Key advantages of this approach include the ability to study MsbA in different membrane environments and to capture transient conformational states that might be difficult to observe with crystallography .

Solid-State NMR Spectroscopy:
This technique allows study of membrane-embedded MsbA without crystallization constraints :

  • Isotopic labeling of specific amino acids or domains

  • Sample preparation in native-like lipid environments

  • Analysis of chemical shifts and dipolar couplings to determine:

    • Local secondary structure

    • Transmembrane helix orientation

    • Dynamic processes on various timescales

Fluorescence Spectroscopy Approaches:

  • FRET (Förster Resonance Energy Transfer):

    • Introduction of donor and acceptor fluorophores at strategic positions

    • Measurement of energy transfer as a function of nucleotide binding and hydrolysis

    • Real-time monitoring of distance changes during the transport cycle

  • Single-molecule FRET:

    • Observations of conformational changes in individual MsbA molecules

    • Ability to detect rare or transient conformational states

    • Correlation of conformational transitions with functional states

Integrative Methodological Framework:
Combining these spectroscopic approaches with functional assays and structural data yields a comprehensive understanding of the MsbA transport mechanism:

  • Identify key residues for labeling based on structural data

  • Monitor conformational changes using multiple spectroscopic techniques

  • Correlate spectroscopic observations with functional measurements

  • Develop and refine mechanistic models of the transport cycle

This multi-technique approach has revealed that MsbA undergoes significant conformational changes during its transport cycle, including rearrangements in both the nucleotide-binding domains and the transmembrane domains .

What are the major technical challenges in studying MsbA and how can they be overcome?

Researchers face several significant technical challenges when studying MsbA proteins:

Membrane Protein Expression and Purification:

  • Challenge: Low expression yields and protein instability during purification

  • Solutions:

    • Optimize expression systems (bacterial, yeast, insect cells) for specific MsbA variants

    • Utilize fusion partners to enhance stability and expression

    • Implement high-throughput screening of detergents and buffer conditions

    • Consider nanodiscs or styrene-maleic acid lipid particles (SMALPs) as alternatives to detergent solubilization

Structural Determination:

  • Challenge: Obtaining high-resolution structures of different conformational states

  • Solutions:

    • Implement protein engineering to create more stable constructs

    • Utilize lipid cubic phase crystallization for membrane proteins

    • Apply cryo-EM for structure determination without crystallization

    • Combine lower-resolution structural data with computational modeling

Functional Assays:

  • Challenge: Developing reliable assays for lipid A transport

  • Solutions:

    • Design fluorescently labeled lipid A analogs for transport studies

    • Develop coupled assays linking ATP hydrolysis to transport

    • Implement reconstituted systems with defined lipid composition

    • Utilize liposome-based assays with appropriate controls

Conformational Dynamics:

  • Challenge: Capturing transient intermediates in the transport cycle

  • Solutions:

    • Apply time-resolved spectroscopic techniques

    • Utilize temperature-sensitive mutants for controlled functional studies

    • Implement single-molecule approaches to observe rare conformations

    • Develop conformation-specific antibodies or nanobodies

Species-Specific Variations:

  • Challenge: Extrapolating findings between bacterial species

  • Solutions:

    • Comparative studies across multiple bacterial species

    • Focused analysis on conserved vs. variable regions

    • Functional complementation assays in model organisms

How can computational approaches enhance our understanding of MsbA structure and function?

Computational approaches offer powerful complementary tools for studying MsbA:

Molecular Dynamics Simulations:

  • All-atom MD simulations: Provide insights into conformational dynamics of MsbA in membrane environments on nanosecond to microsecond timescales

  • Coarse-grained simulations: Enable longer timescale simulations to observe larger conformational changes

  • Enhanced sampling techniques: Accelerate the exploration of conformational space to observe rare events

Homology Modeling and Structure Prediction:

  • Template-based modeling using high-resolution structures of homologous ABC transporters

  • Integration of experimental constraints from EPR and other spectroscopic data

  • Refinement using molecular dynamics simulations in explicit membrane environments

Substrate Docking and Transport Pathway Analysis:

  • Identify potential lipid A binding sites through molecular docking

  • Map transport pathways using techniques like steered molecular dynamics

  • Calculate energetic profiles for substrate translocation

Machine Learning Applications:

  • Prediction of functionally important residues based on sequence conservation

  • Classification of conformational states from experimental data

  • Integration of diverse experimental datasets to generate testable hypotheses

Integrative Modeling Framework:
Computational models can integrate data from multiple experimental sources:

Data SourceComputational ApplicationOutcome
EPR spectroscopyDistance restraints in modelingRefined conformational models
HDX-MSIdentification of dynamic regionsMapping of allosteric networks
Mutagenesis dataConstraint-based modelingFunctional relevance of specific residues
Cryo-EM density mapsFlexible fitting of atomic modelsStructural models of different states

These computational approaches can provide mechanistic insights that are difficult to obtain experimentally, generating testable hypotheses and guiding experimental design.

What are the emerging research directions for MsbA in bacterial pathogenesis and antimicrobial development?

Several exciting research directions are emerging at the intersection of MsbA biology, bacterial pathogenesis, and antimicrobial development:

Host-Pathogen Interactions:

  • Investigation of how MsbA-mediated LPS transport affects recognition by host immune receptors

  • Analysis of MsbA's role in bacterial adaptation to host environments

  • Examination of how MsbA activity is regulated during infection

Bacterial Stress Responses:

  • Characterization of MsbA regulation under various stress conditions (pH, antimicrobial peptides, oxidative stress)

  • Investigation of potential post-translational modifications of MsbA during stress

  • Assessment of MsbA's role in biofilm formation and antibiotic tolerance

Novel Antimicrobial Strategies:

  • Development of MsbA inhibitors with species selectivity

  • Design of combination therapies targeting both MsbA and other membrane biogenesis pathways

  • Creation of adjuvants that enhance existing antibiotic efficacy by compromising MsbA function

Systems Biology Approaches:

  • Integration of MsbA function into broader bacterial envelope biogenesis networks

  • Identification of synthetic lethal interactions with MsbA for multi-target drug development

  • Metabolic modeling to predict consequences of MsbA inhibition

Translational Research Opportunities:

  • Development of diagnostic tools based on MsbA function or expression

  • Creation of attenuated vaccine strains through MsbA modulation

  • Design of biosensors utilizing MsbA conformational changes

Methodological Innovations:

  • Application of CRISPR interference for conditional MsbA depletion studies

  • Development of high-throughput screening platforms for MsbA inhibitors

  • Implementation of in vivo imaging approaches to track MsbA-dependent processes during infection

As an essential component of bacterial membrane biogenesis, MsbA represents both a fundamental research interest for understanding bacterial physiology and a promising target for novel antimicrobial development strategies .

How should researchers interpret discrepancies between in vitro and in vivo studies of MsbA function?

When confronted with discrepancies between in vitro and in vivo studies of MsbA function, researchers should consider several key factors:

Potential Sources of Discrepancies:

  • Membrane Environment Differences:

    • In vitro studies often use simplified lipid compositions that may not recapitulate the complex bacterial inner membrane

    • Native membranes contain varied lipids, proteins, and potentially specialized microdomains that could influence MsbA function

    • Solution: Compare results across multiple membrane mimetics (detergents, nanodiscs, liposomes with various lipid compositions)

  • Protein Modification Effects:

    • Recombinant tags necessary for purification may alter protein function

    • Mutations introduced for labeling (e.g., cysteine substitutions for EPR studies) could impact activity

    • Solution: Validate function of modified proteins by complementation assays in MsbA-deficient strains

  • Substrate Complexity:

    • In vitro transport assays often use simplified substrate analogs

    • Natural substrates in vivo may have structural variations that affect transport

    • Solution: Develop more sophisticated substrate analogs that better mimic natural lipid A structures

  • Cellular Context:

    • MsbA may interact with other proteins in vivo that are absent in purified systems

    • Cellular factors may regulate MsbA activity through direct or indirect mechanisms

    • Solution: Identify potential interaction partners through techniques like crosslinking and co-immunoprecipitation

Methodological Approach to Reconciling Discrepancies:

  • Systematic Comparison:
    Create a detailed comparison table of specific parameters:

    ParameterIn Vitro ObservationIn Vivo ObservationPotential Explanation
    ATP hydrolysis ratee.g., 15 nmol/min/mge.g., Estimated 5-fold higherCellular factors enhancing activity
    Substrate specificitye.g., Strict requirementse.g., More promiscuousMembrane environment effects
    Inhibitor sensitivitye.g., IC50 = 10 μMe.g., MIC = 100 μMPermeability barriers, efflux
  • Bridging Experiments:
    Design experiments that progressively increase complexity from in vitro to in vivo:

    • Purified protein → Reconstituted proteoliposomes → Membrane vesicles → Spheroplasts → Intact cells

  • Complementary Techniques:
    Apply multiple methodologies to the same question:

    • Combine spectroscopic, biochemical, and genetic approaches

    • Use both gain-of-function and loss-of-function approaches

  • Genetic Validation:

    • Create mutations based on in vitro findings and test their effects in vivo

    • Use temperature-sensitive mutants to control MsbA function and observe cellular consequences

What are the best practices for analyzing MsbA mutants and interpreting phenotypic data?

Robust analysis of MsbA mutants requires careful experimental design and interpretation:

Design Principles for Mutation Studies:

  • Strategic Mutation Selection:

    • Target conserved motifs (Walker A, Walker B, signature motif) for ATPase function studies

    • Consider evolutionary conservation across species to identify functionally important residues

    • Include both conservative and non-conservative substitutions at key positions

  • Comprehensive Functional Assessment:

    • Growth complementation: Test ability of mutant to support viability in MsbA-depleted strains

    • Biochemical assays: Measure ATP binding, hydrolysis, and lipid transport activities

    • Structural analysis: Assess impact on protein folding and oligomerization

  • Controls and Standardization:

    • Include positive controls (wild-type MsbA) and negative controls (known inactive mutants)

    • Standardize expression levels to avoid artifacts from variable protein abundance

    • Consider the impact of tags and expression systems on mutant phenotypes

Analytical Framework for Phenotypic Data:

  • Mutation-Phenotype Correlation Matrix:

    Mutation TypeGrowth PhenotypeATPase ActivityTransport ActivityConformational Impact
    Walker A (K)LethalSeverely reducedAbolishedDisrupted nucleotide binding
    Walker B (E)Temperature-sensitiveTrapped in ATP-bound stateReducedBlock in catalytic cycle
    Signature motifVariableCoupling defectsVariableDisrupted NBD dimerization
    Transmembrane domainOften lethalMay be normalDefectiveAltered substrate pathway
  • Classification System:
    Categorize mutants based on functional defects:

    • Class I: Defective in protein expression or stability

    • Class II: Defective in ATP binding

    • Class III: Defective in ATP hydrolysis

    • Class IV: Uncoupled (ATP hydrolysis occurs but transport is defective)

    • Class V: Substrate specificity alterations

  • Temperature-Sensitivity Analysis:

    • Compare growth and biochemical parameters at permissive vs. non-permissive temperatures

    • Use temperature shifts to identify rapid vs. cumulative effects

    • Combine with pulse-chase experiments to track lipid transport kinetics

  • Suppressor Analysis:

    • Identify second-site suppressors that restore function to defective mutants

    • Map interactions between residues through double-mutant analysis

    • Construct detailed interaction networks based on genetic data

Interpretation Guidelines:

  • Distinguish between direct effects on catalysis and indirect effects on protein stability

  • Consider the position of mutations within the structure-function framework of ABC transporters

  • Compare results with similar mutations in homologous proteins

  • Integrate phenotypic data with structural and spectroscopic observations

  • Develop mechanistic models consistent with the observed phenotypic patterns

How can researchers effectively integrate structural, biochemical, and genetic data to develop comprehensive models of MsbA function?

Developing comprehensive models of MsbA function requires strategic integration of diverse experimental datasets:

Data Integration Framework:

  • Structural Foundation:
    Begin with available structural data (X-ray, cryo-EM, homology models) to establish the basic architecture and conformational states .

    Critical structural states to consider:

    • Inward-facing (nucleotide-free)

    • ATP-bound intermediate

    • Outward-facing (pre-hydrolysis)

    • Post-hydrolysis transition state

  • Biochemical Characterization Layer:
    Overlay functional data on structural models to correlate structure with activity:

    • ATP binding and hydrolysis kinetics

    • Lipid A transport rates and specificity

    • Effects of pH, temperature, and ionic conditions

    • Inhibitor binding sites and mechanisms

  • Genetic Evidence Layer:
    Incorporate mutational data to validate and refine the model:

    • Lethal mutations identify essential functional elements

    • Conditional mutations reveal state-specific requirements

    • Suppressor mutations map functional interactions

    • Species-specific variations highlight adaptive features

  • Dynamic Information Layer:
    Add insights from techniques that capture protein dynamics:

    • EPR spectroscopy data on local dynamics and accessibility

    • FRET measurements of domain movements

    • Molecular dynamics simulations of conformational changes

    • Hydrogen-deuterium exchange data on flexible regions

Model Development Process:

  • Hypothesis Generation:

    • Start with the established ABC transporter alternating access mechanism

    • Formulate specific hypotheses about MsbA's transport cycle

    • Identify critical steps that may differ from other ABC transporters

  • Model Refinement:

    • Test predictions through targeted experiments

    • Revise model based on new data

    • Focus on resolving contradictions between different data types

  • Quantitative Modeling:

    • Develop kinetic models of the transport cycle

    • Incorporate rate constants from biochemical measurements

    • Simulate the effects of mutations or inhibitors

Visualization and Communication Tools:

  • State Transition Diagrams:
    Create comprehensive diagrams showing:

    • Major conformational states

    • Transition pathways between states

    • Energy barriers for transitions

    • Effects of mutations on specific transitions

  • Integrated Data Tables:
    Compile data from multiple approaches:

    Structural RegionKey ResiduesBiochemical FunctionMutation EffectsSpectroscopic DataConservation
    Walker AK382ATP bindingLethal when mutatedRestricted mobility upon ATP bindingHighly conserved
    Transmembrane helix 3A270Conformational couplingTemperature-sensitive when TDynamic region by EPRVariable
  • Multi-scale Models:
    Develop representations at different levels:

    • Atomic-level details of catalytic sites

    • Domain-level movements during transport cycle

    • Integration with membrane environment

    • Connection to cellular physiology

This integrative approach acknowledges that no single experimental technique can fully capture the complexity of MsbA function and leverages complementary strengths of different methodologies to build a coherent mechanistic model .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.