Recombinant Bordetella bronchiseptica Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

Membrane Protein Insertase YidC from Bordetella bronchiseptica is an essential bacterial protein that plays a crucial role in the insertion and assembly of other proteins into the inner membrane . Based on the available information, YidC is also known by alternative names including Foldase YidC, Membrane integrase YidC, and Membrane protein YidC . The protein is encoded by the yidC gene, which in B. bronchiseptica strain ATCC BAA-588/NCTC 13252/RB50 is designated as BB4993 in the ordered locus names .

The full-length protein consists of 563 amino acids, making it a substantial membrane-associated molecule with diverse functional domains . When produced as a recombinant protein, YidC is typically expressed with an N-terminal histidine tag to facilitate purification and detection in laboratory settings . The protein's fundamental role in bacterial physiology relates to its function in membrane protein biogenesis, a process essential for bacterial survival and adaptation.

Evolutionary Conservation

YidC represents a highly conserved protein family found across all three domains of life . According to the available research, YidC has homologous proteins in other organisms including Oxa1 in the inner membrane of mitochondria and ALB3 in the thylakoid membrane of chloroplasts . This conservation across diverse biological systems highlights the fundamental importance of YidC-like proteins in cellular physiology and membrane protein biogenesis.

The evolutionary conservation of YidC suggests its essential role in membrane biology dates back to early cellular evolution. While specific information about sequence conservation between Bordetella bronchiseptica YidC and other Bordetella species is limited in the available research, studies on other Bordetella proteins have shown varying degrees of conservation between species such as B. pertussis, B. parapertussis, and B. holmesii .

Role in Bacterial Systems

In bacterial systems, YidC functions as a critical component of the membrane protein insertion machinery. The primary role of YidC is to facilitate the insertion and assembly of proteins destined for integration into the bacterial inner membrane . This process is essential for maintaining the integrity and functionality of the bacterial membrane, which serves as a selective barrier between the cell's interior and exterior environments.

The essential nature of YidC in Bordetella and other bacterial systems makes it a potential target for antimicrobial interventions. Understanding the specific functions and mechanisms of B. bronchiseptica YidC could provide insights into pathogenesis and potential therapeutic approaches for managing infections caused by this respiratory pathogen in various mammalian hosts.

Membrane Protein Insertion

The primary function of YidC is to facilitate the insertion of proteins into the bacterial inner membrane . As a membrane protein insertase, YidC aids in the integration of newly synthesized proteins into the lipid bilayer, ensuring their proper orientation and folding within the membrane environment. This process is crucial for the biogenesis of membrane proteins, which serve diverse functions including transport, signaling, and energy production in bacterial cells.

The mechanism of YidC-mediated insertion likely involves recognition of specific features in substrate proteins, such as transmembrane segments or signal sequences, followed by chaperoning of these substrates through the insertion process. The hydrophobic nature of the transmembrane domains of YidC creates an environment that facilitates the partitioning of substrate proteins from the aqueous cytoplasm into the hydrophobic membrane core, a critical step in membrane protein biogenesis.

Role in Protein Assembly

Beyond simple insertion, YidC also plays a role in the assembly and folding of membrane proteins . This function ensures that newly inserted proteins achieve their correct three-dimensional structure, which is essential for their biological activity. The assembly process may involve chaperoning activities that prevent misfolding or aggregation of membrane proteins during their biogenesis.

The importance of YidC in protein assembly is underscored by its conservation across diverse biological systems and its essential nature in many bacterial species. In Bordetella bronchiseptica, proper functioning of YidC would be necessary for maintaining the integrity and functionality of various membrane-associated processes, including those involved in bacterial metabolism, transport, and potentially virulence-related functions.

Comparison with Homologs in Other Species

YidC belongs to a conserved family of membrane protein insertases that includes Oxa1 in mitochondria and ALB3 in chloroplasts . These homologs share fundamental functional similarities despite operating in different cellular compartments and organisms. The conservation suggests a common evolutionary origin and highlights the fundamental importance of this protein family in membrane protein biogenesis across diverse biological systems.

While specific comparisons between Bordetella bronchiseptica YidC and its homologs in other bacterial species are not extensively detailed in the available research, the conservation of function across species suggests shared mechanistic principles. Comparative studies between YidC proteins from different bacterial species, particularly pathogens, could provide valuable insights into potential species-specific adaptations and targetable differences for therapeutic development.

Expression Systems

Recombinant Bordetella bronchiseptica Membrane Protein Insertase YidC is typically produced using Escherichia coli expression systems . According to the available product information, the full-length protein (residues 1-563) can be expressed in E. coli with an N-terminal histidine tag to facilitate purification and detection . The expression of membrane proteins like YidC in heterologous systems presents technical challenges due to their hydrophobic nature and requirements for membrane integration.

Successful production of recombinant YidC requires optimization of expression conditions, including selection of appropriate E. coli strains, expression vectors, and induction parameters. The specific challenges associated with expressing a multi-transmembrane domain protein like YidC necessitate careful consideration of factors such as potential toxicity to the host cells, proper folding, and prevention of inclusion body formation during the expression process.

Purification Methods

The purification of recombinant YidC typically involves affinity chromatography utilizing the attached histidine tag . This method allows for selective binding of the recombinant protein to a nickel or cobalt resin, followed by washing steps to remove contaminants and elution with imidazole or other competitive agents. Additional purification steps might include size exclusion chromatography or ion exchange chromatography to achieve higher purity.

Given the membrane-associated nature of YidC, detergents or other solubilizing agents are necessary during extraction and purification to maintain protein solubility and native-like conformation. The choice of detergent and buffer conditions is critical for preserving the structural integrity and functionality of the recombinant protein. Commercial preparations of recombinant YidC achieve greater than 90% purity as determined by SDS-PAGE analysis .

Research Applications

Recombinant Bordetella bronchiseptica Membrane Protein Insertase YidC has various applications in research settings. As a key component of bacterial membrane protein biogenesis, recombinant YidC can be used for structural studies to elucidate the molecular mechanisms of membrane protein insertion, biochemical assays to identify substrate proteins and interaction partners, and development of in vitro membrane protein insertion systems.

The availability of purified recombinant YidC enables detailed investigations into membrane protein folding and assembly pathways, which remain among the challenging areas in structural biology. Additionally, YidC can serve as a model system for studying membrane protein biogenesis across different bacterial species, contributing to our understanding of fundamental cellular processes and potentially revealing species-specific differences that could be exploited for targeted interventions.

Potential Therapeutic Targets

Given the essential nature of YidC in bacterial systems, it represents a potential target for antimicrobial interventions. Bordetella bronchiseptica is a respiratory pathogen of various mammals, including dogs, pigs, and occasionally humans. By targeting YidC or its function, it may be possible to disrupt the bacterium's membrane integrity or protein biogenesis, thereby inhibiting its growth or virulence.

Future Research Directions

Future research on Bordetella bronchiseptica YidC could explore several promising directions, including detailed structural analysis using advanced techniques like cryo-electron microscopy or X-ray crystallography to determine the complete three-dimensional structure, identification and characterization of specific substrate proteins that depend on YidC for membrane insertion in B. bronchiseptica, and investigation of potential differences in YidC function between B. bronchiseptica and related pathogenic species.

Additional research avenues could include development of high-throughput screening methods to identify specific inhibitors of YidC function and exploration of YidC's role in bacterial pathogenesis and host-pathogen interactions. The recombinant protein serves as a valuable tool for these investigations, enabling both in vitro and potentially in vivo studies to elucidate the multiple facets of YidC biology in Bordetella and related bacterial pathogens.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; BB4993; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-563
Protein Length
full length protein
Species
Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)
Target Names
yidC
Target Protein Sequence
MDIRRTVLWMIFSFSLLLLWNNWQIHNGKPSLFGGPAPEAAATQQPKADANGTAASSTAS IPSSPAAAPAAASVPGAAAPAAAKSEQVVITTDVLRLTFDSNGAQLIRAELLKYPSSSQS DKPTVLMDRSADLVYVAQTGVVGAPQGESFPTHQTPFHLVSSERSLTGDTLDVVFEAESG GLKVTKTYTLHRGRYDVDVRHAMANTGGAPLNPALYLQLERDGTDPAGTSSFYHTFTGVA VYSEQDKFQKVTFSDIEKKKGTYIKQADNGWIGIVQHYFATAWIPAQGKQRTNELLQVQQ NLYAARTIEAVGTIAPGSSANVDAHLWVGPQDQKAMAAVAPGLELVVDYGWLTIIAKPLF TLMTWLHGLLGNWGWTIVALTVIIKAVFFPLAAASYRSMARMKQVAPRLQALKEKYGDDR QKLNQAMMEMYRTEKINPLGGCLPMVVQIPVFIALYWVLLASVEMRGAPWILWVHDLSVR DPFFILPAIMMATMFLQIKLNPTPPDPVQAKVMMIMPLVFGGMMFFFPAGLVLYWCVNNT LSIAQQWTITRNLERQAAAAANR
Uniprot No.

Target Background

Function
YidC is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. YidC also assists in the folding of multispanning membrane proteins.
Database Links

KEGG: bbr:BB4993

STRING: 257310.BB4993

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its primary function in Bordetella bronchiseptica?

YidC is an essential bacterial membrane protein that facilitates the insertion and assembly of proteins destined for integration into the inner membrane. In Bordetella bronchiseptica, as in other Gram-negative bacteria, YidC serves as a membrane protein insertase that can function either independently or in concert with the SecY complex to mediate co-translational membrane protein integration . The insertase activity of YidC is primarily located in the C-terminal five transmembrane regions, which are highly conserved across bacterial species .

How is the structure of B. bronchiseptica YidC organized?

Based on structural studies of bacterial YidC proteins, B. bronchiseptica YidC likely consists of six transmembrane (TM) domains with a large periplasmic domain (approximately 35 kDa) located between TM1 and TM2 . The core structure forms a helical bundle arranged like the vertices of a pentagon when viewed from the cytoplasm, with TM helices organized in the order 4-5-3-2-6 (clockwise) . The first transmembrane helix (TM1) lies along the periphery of this core structure as revealed in the crystal structure of Thermotoga maritima YidC . The conserved membrane-integrated core of YidC forms this pentagonal arrangement that creates a hydrophilic groove at the protein-lipid interface, which likely serves as the insertion site for substrate proteins .

What experimental systems are available for expressing recombinant B. bronchiseptica YidC?

For recombinant expression of B. bronchiseptica YidC, researchers typically employ E. coli expression systems using vectors containing inducible promoters such as T7. The standard approach involves:

  • Cloning the yidC gene from B. bronchiseptica into an expression vector with a C-terminal or N-terminal affinity tag (such as His-tag)

  • Transforming the construct into an E. coli expression strain such as BL21(DE3)

  • Growing cultures at 37°C to an appropriate optical density (typically A600 of 0.6)

  • Inducing expression with IPTG (typically 1 mM)

  • Harvesting cells after 3-4 hours of induction

  • Lysing cells using mechanical disruption methods such as sonication or pressure-based systems (e.g., Emulsiflex)

Purification is then performed using affinity chromatography, followed by size exclusion chromatography to obtain pure protein for functional and structural studies.

How do I design an effective in vivo complementation assay to assess B. bronchiseptica YidC function?

An in vivo complementation assay for B. bronchiseptica YidC function can be designed based on the essential nature of YidC in bacterial cells. The methodology involves:

  • Constructing a conditional YidC depletion strain in E. coli where the endogenous yidC gene is under control of an inducible promoter

  • Transforming this strain with a plasmid expressing B. bronchiseptica YidC

  • Shifting growth conditions to deplete endogenous YidC

  • Assessing whether B. bronchiseptica YidC can rescue growth

For mutational analysis, key residues can be selected based on evolutionary conservation and structural models. Critical residues like those corresponding to E. coli T362 in TM2 and Y517 in TM6 are excellent candidates for alanine substitution mutagenesis to assess their importance in YidC function . After mutagenesis, expression levels should be confirmed by western blotting to ensure that any functional defects observed are not due to protein instability .

What regions of B. bronchiseptica YidC are most critical for its insertase function?

Based on deletion analyses and structural studies of YidC from other bacteria, the insertase function of B. bronchiseptica YidC is likely concentrated in the C-terminal five transmembrane regions (TM2-TM6) . While up to 90% of the large periplasmic domain between TM1 and TM2 can be deleted without severely affecting cell viability or inner membrane protein biogenesis in E. coli YidC , the C-terminal residues 323-346 of this periplasmic domain (corresponding to a conserved α-helix) are essential for insertase activity .

Additionally, molecular dynamics simulations and mutational studies have identified specific residues within the transmembrane domains that are critical for stability and function. These include residues involved in:

  • Polar or charged interactions on the cytoplasmic side of the protein core

  • Aromatic residue stacking on the periplasmic side

  • Specific interhelical interactions, particularly between TM2 and TM6

How can I assess the interaction between B. bronchiseptica YidC and translating ribosomes?

To assess YidC-ribosome interactions, researchers can employ the following methodology:

  • Generate ribosome-nascent chain complexes (RNCs) by:

    • Constructing templates for in vitro transcription/translation containing the first transmembrane segment of a known YidC substrate

    • Adding a translation arrest sequence to stabilize the ribosome-nascent chain complex

    • Performing in vitro translation in the presence of purified B. bronchiseptica YidC in detergent micelles

  • Analyze the complexes using:

    • Sucrose gradient centrifugation to isolate RNC-YidC complexes

    • Cryo-electron microscopy (cryo-EM) to visualize the structural arrangement

    • Chemical cross-linking followed by mass spectrometry to identify specific contact points

Cryo-EM analysis has revealed that YidC binds to the ribosomal tunnel exit with the nascent transmembrane helix positioned near YidC's TM3 . This technique allows visualization of how a single copy of YidC interacts with the ribosome and identifies the site for membrane protein insertion at the YidC protein-lipid interface .

How do I design experiments to distinguish between Sec-dependent and Sec-independent YidC-mediated insertion pathways using B. bronchiseptica YidC?

To investigate the dual functionality of B. bronchiseptica YidC in Sec-dependent and Sec-independent insertion pathways, researchers can implement the following experimental approach:

  • Substrate selection:

    • Choose known YidC-only substrates (e.g., Pf3 coat protein, M13 procoat)

    • Select SecYEG-YidC dependent substrates (e.g., FtsQ, CyoA)

    • Include B. bronchiseptica-specific inner membrane proteins

  • In vitro reconstitution system:

    • Purify B. bronchiseptica YidC and reconstitute into proteoliposomes

    • Prepare separate proteoliposomes containing SecYEG complex

    • Create combined proteoliposomes with both SecYEG and YidC

    • Use fluorescently labeled substrate proteins to track insertion

  • Analysis of insertion efficiency:

    • Protease protection assays to assess topology

    • Sucrose flotation assays to confirm membrane integration

    • Fluorescence-based real-time insertion assays

  • Crosslinking analysis:

    • Incorporate photoactivatable or chemical crosslinkers at specific positions in substrate proteins

    • Identify crosslinked adducts by mass spectrometry to map interaction sites

    • Compare crosslinking patterns between YidC-only and SecYEG+YidC systems

These experiments would provide mechanistic insights into how B. bronchiseptica YidC functions independently and in concert with the Sec machinery, potentially revealing species-specific adaptations in membrane protein biogenesis pathways.

What are the critical differences between YidC homologues across bacterial species, and how might these affect functional studies of B. bronchiseptica YidC?

The evolutionary conservation and divergence patterns among YidC homologues can significantly impact experimental design and interpretation when studying B. bronchiseptica YidC:

FeatureE. coli YidCB. bronchiseptica YidCT. maritima YidCB. halodurans YidC2Functional Implications
Periplasmic domain sizeLarge (~35 kDa)Large (predicted)ReducedReducedMay affect interactions with extracytoplasmic factors
TM1 positionPeripheralPeripheral (predicted)Resolved in crystal structureNot well definedPotential role in substrate selection
Conserved core (TM2-6)PresentPresentPresentPresentEssential for insertase function
C-terminal cytoplasmic domainPresentPresent (predicted)VariableExtendedSpecies-specific ribosome interactions

When designing functional complementation studies, researchers should consider:

  • The conservation level of specific residues between E. coli and B. bronchiseptica YidC, especially in:

    • The hydrophilic groove formed by TM3 and TM5, which is implicated in substrate binding

    • The cytoplasmic ribosome-binding regions

    • The C-terminal α-helix of the periplasmic domain that is essential for function

  • Specific adaptations that may reflect the pathogenic lifestyle of B. bronchiseptica, potentially affecting:

    • Substrate specificity for virulence factors

    • Membrane protein insertion under stress conditions encountered during infection

Cross-species complementation assays can reveal functionally interchangeable regions versus species-specific domains that have evolved distinct functions .

How can molecular dynamics simulations be used to predict critical functional residues in B. bronchiseptica YidC for experimental validation?

Molecular dynamics (MD) simulations provide powerful tools for predicting functionally important residues in B. bronchiseptica YidC prior to experimental testing:

  • Model generation and refinement:

    • Build a homology model of B. bronchiseptica YidC based on crystal structures of homologues

    • Embed the model in a lipid bilayer mimicking the bacterial inner membrane composition

    • Perform equilibration simulations (typically 100-500 ns) to stabilize the system

  • Analysis of inter-residue interactions:

    • Calculate interaction energies between residues to identify stabilizing contacts

    • Focus on hydrophobic residues on the exterior that mediate lipid interactions

    • Identify polar/charged residues that form networks within the protein core

    • Pay special attention to aromatic residues on the periplasmic side that participate in stacking interactions

  • Substrate channel analysis:

    • Simulate water penetration into the hydrophilic groove formed between TM segments

    • Track the dynamics of the groove dimensions to identify potential gating mechanisms

    • Use steered MD to model nascent chain insertion pathways

  • Experimental validation strategy:

    • Select 10-15 residues with the highest predicted interaction energies

    • Generate alanine substitution mutants (or more conservative substitutions for critical residues)

    • Test using in vivo complementation assays described above

    • Verify protein stability using western blotting

    • For functional mutants, perform detailed biophysical characterization

Previous MD simulations with E. coli YidC identified critical residues T362 in TM2 and Y517 in TM6, which completely inactivated YidC when mutated to alanine despite stable expression . Similar approaches can identify the corresponding crucial residues in B. bronchiseptica YidC.

What methods can be used to solve the structure of B. bronchiseptica YidC, and what special considerations apply?

Multiple complementary approaches can be employed to determine the structure of B. bronchiseptica YidC:

  • X-ray crystallography:

    • Focus on crystallizing the periplasmic domain separately, as demonstrated for E. coli YidC

    • Consider limited proteolysis to identify stable fragments

    • Engineer surface mutations to enhance crystallization (as in the E. coli YidC periplasmic domain where mutations E228A, K229A, E231A, K232A, and K234A improved crystal quality)

    • Use lipidic cubic phase crystallization for the full-length protein

  • Cryo-electron microscopy:

    • Prepare YidC in detergent micelles or nanodiscs

    • Consider ribosome-bound complexes to enhance particle size and aid in alignment

    • Use substrate-engaged YidC to capture functional states

  • Integrative structural biology approaches:

    • Employ evolutionary covariation analysis to predict residue contacts as successfully used for E. coli YidC

    • Validate models using lipid versus protein exposure prediction methods

    • Combine with molecular dynamics simulations to refine structural models

    • Incorporate crosslinking data to constrain model building

Special considerations for B. bronchiseptica YidC include optimizing detergent selection for extraction from membranes, addressing potential flexibility in the periplasmic domain, and capturing functionally relevant conformational states during the insertion process.

How can I investigate the substrate specificity of B. bronchiseptica YidC in the context of pathogenesis?

To investigate the substrate specificity of B. bronchiseptica YidC with particular focus on virulence factors:

  • Substrate identification:

    • Perform comparative proteomics of membrane proteins in YidC-depleted versus wild-type B. bronchiseptica

    • Use SILAC (stable isotope labeling with amino acids in cell culture) to quantify changes in protein abundance

    • Conduct in vivo crosslinking followed by immunoprecipitation and mass spectrometry to identify direct YidC interactors

    • Focus on virulence factors that require membrane insertion for function

  • Validation of YidC dependence:

    • Construct conditional YidC depletion strains in B. bronchiseptica

    • Assess localization of candidate substrates using fractionation and western blotting

    • Employ in vitro translation/insertion assays with purified components

    • Perform site-specific crosslinking to map YidC-substrate contact sites

  • Pathogenesis-relevant functional analysis:

    • Evaluate the impact of YidC depletion on B. bronchiseptica adherence to respiratory epithelial cells

    • Assess secretion of virulence factors that require proper membrane protein insertion

    • Examine biofilm formation capacity under YidC limitation

    • Test virulence in appropriate animal models with regulated YidC expression

This methodology would reveal whether B. bronchiseptica YidC has evolved specific adaptations for inserting pathogenesis-related membrane proteins and could identify novel targets for antimicrobial development.

How can I establish a cell-free translation system to study B. bronchiseptica YidC-mediated membrane protein insertion?

A reconstituted cell-free translation system provides precise control over the components involved in YidC-mediated insertion:

  • Cell-free extract preparation:

    • Prepare S30 extract from B. bronchiseptica or E. coli

    • Deplete endogenous YidC using immunoaffinity methods

    • Supplement with T7 RNA polymerase for coupled transcription-translation

  • Membrane mimetics:

    • Prepare proteoliposomes containing purified B. bronchiseptica YidC

    • Control lipid composition to mimic B. bronchiseptica inner membrane

    • Use nanodiscs as an alternative membrane system for better accessibility

  • Translation reaction setup:

    • Use plasmids encoding YidC substrates under T7 promoter control

    • Include fluorescently labeled lysine-tRNA or cysteine-reactive fluorophores for detection

    • Add purified B. bronchiseptica YidC at varying concentrations

    • Compare wild-type YidC with specific point mutants

  • Analysis methods:

    • Monitor insertion using protease protection assays

    • Employ sucrose gradient centrifugation to isolate membrane-integrated products

    • Use FRET-based assays to track real-time insertion kinetics

    • Analyze topology using substituted cysteine accessibility method (SCAM)

This system allows systematic variation of components to dissect the minimal requirements for B. bronchiseptica YidC-mediated insertion and can reveal substrate-specific insertion mechanisms.

What approaches can be used to study the interaction between B. bronchiseptica YidC and the Sec translocon complex?

To investigate the YidC-SecYEG interaction in B. bronchiseptica:

  • Biochemical interaction analysis:

    • Co-purification studies using affinity-tagged YidC or SecY

    • Pull-down assays to identify stable complexes

    • Blue native PAGE to visualize native complexes

    • Surface plasmon resonance to measure binding kinetics

    • Focus on the region corresponding to residues 215-265 in E. coli YidC, shown to be sufficient for SecF binding

  • Structural characterization:

    • Crosslinking-MS to map interaction interfaces

    • Negative stain EM of purified complexes

    • Cryo-EM to visualize YidC-SecYEG-ribosome assemblies

    • Construct fusion proteins to stabilize transient interactions

  • Functional analysis:

    • Reconstitute purified YidC and SecYEG into proteoliposomes

    • Compare insertion efficiency of model substrates requiring both YidC and SecYEG

    • Mutate predicted interface residues and assess impact on complex formation

    • Deploy in vivo assays measuring membrane protein biogenesis of SecYEG-YidC dependent substrates

  • Real-time visualization:

    • Utilize fluorescently labeled YidC and SecY to track complex formation using single-molecule techniques

    • Employ FRET to monitor conformational changes during substrate handling

    • Develop split fluorescent protein complementation assays to visualize interaction in living cells

These approaches would provide insights into whether the B. bronchiseptica YidC-Sec interaction has specific adaptations compared to model organisms like E. coli.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.