Recombinant Bordetella bronchiseptica NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nuoK; BB3831; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)
Target Names
nuoK
Target Protein Sequence
MTLTLAHYLILGAILFAIGIFGIFLNRRNLIILLMSIELVLLAVNMNFVAFSSWFGDIAG QVFVFFILTVAAAEAAIGLAILVLLFRNLNTINVDELDRLKG
Uniprot No.

Target Background

Function
NDH-1 (NADH-quinone oxidoreductase subunit K) facilitates electron transfer from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this species, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled with proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy within a proton gradient.
Database Links

KEGG: bbr:BB3831

STRING: 257310.BB3831

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of NADH-quinone oxidoreductase subunit K (nuoK) in Bordetella bronchiseptica?

NADH-quinone oxidoreductase subunit K (nuoK) is an integral membrane protein component of respiratory Complex I in Bordetella bronchiseptica. This complex catalyzes the first step of the electron transport chain, transferring electrons from NADH to ubiquinone while simultaneously translocating protons across the bacterial membrane. The nuoK subunit specifically contributes to the membrane domain of Complex I involved in proton translocation, which is critical for generating the proton motive force necessary for ATP synthesis.

In respiratory pathogens like B. bronchiseptica, which causes infections ranging from mild respiratory symptoms to severe bronchopneumonia, efficient energy generation is essential for colonization and persistence in host tissues . As B. bronchiseptica is pervasive in swine populations and contributes to porcine respiratory disease complex, the proper functioning of energy-generating systems like Complex I may be particularly relevant to its pathogenicity and persistence in the respiratory tract .

Structurally, nuoK contains three transmembrane helices that interact with neighboring subunits to form part of the proton translocation pathway. Although small in size compared to other Complex I components, nuoK plays a crucial role in maintaining the structural integrity of the complex and contributing to its proton-pumping mechanism.

What expression systems are most effective for producing recombinant Bordetella bronchiseptica nuoK protein?

Several expression systems can be employed for the production of recombinant B. bronchiseptica nuoK, each with distinct advantages:

E. coli-based expression systems:

  • BL21(DE3) strains with pET vectors containing a His-tag for purification

  • C41(DE3) and C43(DE3) strains specifically engineered for membrane protein expression

  • Fusion partners such as maltose-binding protein (MBP) or SUMO to enhance solubility

Eukaryotic expression systems:

  • Baculovirus expression in insect cells (Sf9 or Hi5) offers a more complex membrane environment that may better support proper folding

  • Yeast systems (Pichia pastoris or Saccharomyces cerevisiae) combine ease of genetic manipulation with eukaryotic membrane composition

Cell-free expression systems:

  • Allow direct incorporation into liposomes or nanodiscs during synthesis

  • Eliminate toxicity issues that may arise when expressing membrane proteins in living cells

Based on information about Bordetella protein expression, E. coli or yeast systems are commonly used as starting points, but membrane proteins often require extensive optimization . For nuoK specifically, a systematic comparison of different expression conditions (temperature, induction method, detergents) is advisable to determine optimal parameters.

What purification methods yield the highest purity and functionality of recombinant nuoK protein?

Purification of recombinant Bordetella bronchiseptica nuoK requires specialized approaches suitable for membrane proteins:

Initial extraction and solubilization:

  • Selective membrane isolation using ultracentrifugation

  • Careful detergent screening (common choices include n-dodecyl β-D-maltoside, lauryl maltose neopentyl glycol, or digitonin)

  • Optimization of detergent-to-protein ratio to prevent aggregation while maintaining structure

Chromatographic purification:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA for His-tagged nuoK

  • Size exclusion chromatography to separate monomeric nuoK from aggregates

  • Ion exchange chromatography as a polishing step based on nuoK's theoretical isoelectric point

Stabilization considerations:

  • Addition of phospholipids to maintain native-like environment

  • Glycerol (10-15%) to prevent aggregation

  • Reducing agents to prevent oxidation of cysteine residues

  • Complete protease inhibitor cocktails to prevent degradation

The purification protocol should be validated at each step using techniques such as SDS-PAGE, Western blotting, and activity assays if reconstitution with other Complex I components is possible. The goal should be to achieve >95% purity while maintaining the protein in a native-like conformation, which is essential for downstream structural and functional studies.

How does the amino acid sequence of Bordetella bronchiseptica nuoK compare with homologs in other respiratory pathogens?

Comparative sequence analysis of Bordetella bronchiseptica nuoK with homologs in other pathogens reveals significant evolutionary conservation, reflecting the essential nature of Complex I in bacterial energy metabolism:

Within Bordetella species:

  • High sequence identity (>90%) with B. pertussis and B. parapertussis nuoK, consistent with the close phylogenetic relationship among these classical Bordetella species

  • This conservation extends to other recently described Bordetella species, though with slightly lower identity percentages

Comparison with other respiratory pathogens:

  • Moderate sequence identity (40-60%) with nuoK homologs in other gram-negative respiratory pathogens like Pseudomonas species

  • Lower but significant homology (30-45%) with more distantly related pathogens

Functionally important conserved regions:

  • Highly conserved transmembrane helices with preserved charged residues at key positions involved in proton translocation

  • Specific residues at subunit interfaces that maintain crucial interactions with other Complex I components

  • Conservation of residues involved in quinone binding and electron transfer

This conservation pattern provides valuable guidance for researchers designing mutagenesis studies, as alterations in highly conserved residues would likely have significant functional consequences. The high degree of conservation also suggests potential for broad-spectrum therapeutic approaches targeting this essential respiratory component.

What experimental approaches can be used to determine the role of nuoK in Bordetella bronchiseptica virulence and pathogenesis?

Investigating the role of nuoK in B. bronchiseptica virulence requires a multi-faceted approach:

Genetic manipulation strategies:

  • Construction of clean nuoK deletion mutants using allelic exchange or CRISPR-Cas systems

  • Creation of point mutations in functionally important residues to disrupt specific activities

  • Complementation studies with wild-type or mutant nuoK to confirm phenotypes

  • Conditional expression systems to study nuoK depletion effects at different infection stages

In vitro characterization:

  • Growth curve analysis under various conditions (nutrient limitation, oxidative stress, pH variation)

  • Biofilm formation assessment to determine if energy metabolism affects this virulence trait

  • Adherence assays to respiratory epithelial cells

  • Measurement of metabolic parameters (membrane potential, ATP production, NADH oxidation rates)

Animal infection models:

  • Respiratory infection models in natural hosts (swine, dogs) or surrogate models (mice)

  • Competitive index assays comparing wild-type and nuoK mutants during infection

  • Histopathological analysis to assess tissue damage patterns

  • Bacterial burden quantification in different respiratory tract regions over time

Host response analysis:

  • Transcriptomics of host tissues infected with wild-type versus nuoK mutants

  • Cytokine/chemokine profiling to assess immunomodulatory effects

  • Neutrophil recruitment and function studies

B. bronchiseptica's role in swine respiratory diseases makes these approaches particularly relevant for understanding how metabolic functions like those mediated by nuoK contribute to its success as a respiratory pathogen . The bacterium's ability to cause a spectrum of disease outcomes, from asymptomatic carriage to severe pneumonia, suggests that energy metabolism may be differentially regulated during various infection stages.

How can recombinant nuoK be utilized in developing targeted antimicrobial strategies against beta-lactam resistant strains?

Recombinant Bordetella bronchiseptica nuoK offers several avenues for antimicrobial development against resistant strains:

Target-based drug discovery approaches:

  • High-throughput screening using purified recombinant nuoK to identify specific inhibitors

  • Structure-based drug design once the three-dimensional structure is determined

  • Fragment-based screening to identify chemical scaffolds that bind to critical functional sites

Rationale for targeting nuoK:

  • As a component of the respiratory chain, nuoK inhibition would disrupt energy metabolism—a process essential for bacterial survival regardless of beta-lactam resistance

  • Research confirms that B. bronchiseptica isolates harbor the beta-lactamase gene blaBOR, making them resistant to beta-lactams, thus necessitating alternative targets

  • The nuoK protein represents an orthogonal approach to cell wall synthesis inhibition

Combination therapy potential:

  • Testing synergistic effects between potential nuoK inhibitors and conventional antibiotics

  • Establishing whether respiratory chain inhibition can resensitize resistant strains to lower concentrations of beta-lactams

  • The prevalence of both beta-lactam and macrolide resistance in B. bronchiseptica isolates emphasizes the need for novel targets

Practical considerations:

  • Ensuring selectivity over mammalian respiratory complex components

  • Pharmacokinetic optimization for respiratory tract penetration

  • Assessment of resistance development potential through laboratory evolution studies

This approach is particularly promising given that B. bronchiseptica isolates demonstrate resistance to multiple antibiotic classes including beta-lactams, macrolides, and pleuromutilins, as documented in recent studies .

What structural biology techniques are most appropriate for resolving the membrane topology of Bordetella bronchiseptica nuoK?

Resolving the membrane topology of nuoK requires specialized structural biology approaches suitable for membrane proteins:

Cryo-Electron Microscopy (Cryo-EM):

  • Single-particle cryo-EM can resolve the structure of the entire Complex I including nuoK

  • Advantages include visualization in a near-native environment without crystallization

  • Recent advances allow for resolutions below 3Å for membrane protein complexes

  • Particularly valuable for visualizing nuoK in its native context within the respiratory complex

X-ray Crystallography:

  • Though challenging for membrane proteins, has been successful for respiratory complex components

  • Requires stabilization through detergent selection, lipidic cubic phase methods, or antibody fragment co-crystallization

  • Can provide atomic-level resolution of nuoK structure

  • May require engineering (e.g., fusion proteins, thermostabilizing mutations) to facilitate crystallization

Complementary Topological Mapping Techniques:

  • Cysteine scanning mutagenesis combined with accessibility assays

  • Reporter fusion analysis (PhoA/LacZ) to map transmembrane segment orientation

  • Proteolytic digestion patterns in native membranes versus detergent-solubilized states

  • Chemical crosslinking mass spectrometry (XL-MS) to identify proximity relationships

Computational Methods:

  • Transmembrane helix prediction algorithms to generate initial topology models

  • Molecular dynamics simulations of nuoK in lipid bilayers to refine structural hypotheses

  • Homology modeling based on known structures from related organisms

A multi-technique approach combining high-resolution structural methods with biochemical topology mapping provides the most comprehensive understanding of nuoK membrane topology. This information is critical for understanding how nuoK contributes to the proton translocation mechanism of Complex I.

How does mutation of the nuoK gene affect electron transport chain efficiency and bacterial fitness?

Mutation of the nuoK gene in Bordetella bronchiseptica has cascading effects on respiratory function and fitness:

Impact on Complex I Function:

  • Disruption of nuoK causes destabilization of the entire Complex I structure

  • Reduced NADH oxidation capacity and diminished proton pumping efficiency

  • Potential compensatory upregulation of alternative NADH dehydrogenases

  • Altered quinone pool redox state affecting downstream respiratory complexes

Bioenergetic Consequences:

  • Decreased proton motive force generation affects ATP synthesis

  • Reduced energy availability for nutrient transport, particularly in nutrient-limited environments

  • Impaired maintenance of ion gradients necessary for cellular homeostasis

  • Metabolic rewiring to compensate for energy deficiency

Growth and Survival Phenotypes:

  • Growth rate reduction, particularly under aerobic conditions

  • Increased doubling time in minimal media compared to rich media

  • Impaired survival during stationary phase due to energy limitations

  • Compromised resistance to environmental stresses

Host-Pathogen Interaction Effects:

  • Potentially reduced ability to colonize the respiratory epithelium

  • Altered expression of virulence factors whose regulation is linked to metabolic state

  • Compromised ability to persist within host tissues during chronic infection

  • Possible attenuation in animal models of B. bronchiseptica infection

Given B. bronchiseptica's role in porcine respiratory disease complex and atrophic rhinitis, understanding how nuoK mutation affects fitness is particularly relevant for comprehending its persistence in swine populations . The bacterium's adaptability to different host environments likely depends on efficient energy generation through intact respiratory complexes.

How can isotope labeling be used to track electron transfer pathways through the nuoK subunit?

Isotope labeling provides powerful approaches for tracking electron transfer pathways through the nuoK subunit in reconstituted systems:

Hydrogen/Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Exchange of hydrogen atoms with deuterium occurs at different rates depending on protein structure and dynamics

  • Regions of nuoK involved in conformational changes during electron transfer will show altered exchange rates

  • Time-resolved HDX-MS can map the progression of structural changes associated with electron movement

Selective Isotopic Labeling for Spectroscopic Studies:

  • 15N, 13C, and 2H labeling of specific amino acids in nuoK predicted to be involved in electron transfer

  • Site-specific labeling of neighboring subunits to detect intersubunit electron movement

  • Pulse EPR techniques with isotopically labeled samples to measure distances between redox centers

Experimental Protocol for Reconstituted System Analysis:

  • Expression of recombinant nuoK with specific isotopic labels

  • Reconstitution with other complex I subunits in defined lipid environment

  • Addition of isotopically labeled electron donors/acceptors

  • Time-resolved spectroscopic monitoring of electron transfer events

  • Correlation of spectroscopic changes with structural dynamics

Real-time Monitoring Approaches:

  • Rapid freeze-quench techniques coupled with EPR to capture intermediates

  • Time-resolved FTIR with isotopically labeled samples to detect bond vibrations during catalysis

  • Stopped-flow spectroscopy with labeled substrates to measure reaction kinetics

These approaches collectively provide a comprehensive view of how electrons move through Complex I and specifically how the nuoK subunit participates in this essential bioenergetic process, which is fundamental to B. bronchiseptica's energy metabolism and potentially its virulence.

What are the most effective methods for studying protein-protein interactions between nuoK and other subunits?

Studying protein-protein interactions involving nuoK requires specialized approaches suitable for membrane protein complexes:

Crosslinking-based Methods:

  • Chemical crosslinking with mass spectrometry analysis (XL-MS) to identify proximity relationships

  • Photo-activatable crosslinkers incorporated at specific positions in nuoK

  • In vivo crosslinking followed by pull-down assays to capture native interactions

  • Zero-length crosslinkers like EDC to identify directly interacting residues

Co-purification Approaches:

  • Sequential tandem affinity purification with tags on nuoK and potential partners

  • Native gel electrophoresis to preserve complexes during separation

  • Size exclusion chromatography combined with multi-angle light scattering to determine complex stoichiometry

  • Gradient centrifugation to separate intact complexes based on size

Genetic and Functional Approaches:

  • Suppressor mutation analysis to identify compensatory mutations in partner subunits

  • Bacterial two-hybrid systems adapted for membrane proteins

  • Disulfide crosslinking between engineered cysteines to validate predicted interfaces

  • Complementation studies with chimeric subunits to map functional interaction domains

Structural Methods:

  • Single-particle cryo-EM of the entire complex at varying detergent concentrations

  • Hydrogen-deuterium exchange mass spectrometry to identify protected regions

  • Solid-state NMR of reconstituted subcomplexes

Each of these methods provides complementary information about nuoK interactions, and combining multiple approaches yields the most comprehensive understanding of how this subunit integrates into the complete respiratory complex structure in B. bronchiseptica.

How does the function of nuoK compare between different growth conditions that mimic host microenvironments?

The function of nuoK in Bordetella bronchiseptica likely varies significantly across different conditions that mimic host microenvironments:

Oxygen Availability Conditions:

  • Fully aerobic environments (upper respiratory tract): nuoK likely functions optimally as part of Complex I

  • Microaerobic conditions (biofilms, mucus-embedded growth): potential shift to alternative respiratory pathways

  • Oxygen-limited environments (deep tissue): possible downregulation of nuoK expression

Nutrient Availability Scenarios:

  • Nutrient-rich conditions: high nuoK activity supporting rapid growth

  • Iron-limited environments (host sequestration): potential coordination between iron acquisition systems and respiratory components

  • Carbon source variation: different substrates affect NADH/NAD+ ratios and electron flow through Complex I

Host Defense Mechanisms:

  • Oxidative stress exposure: nuoK function may be compromised by reactive oxygen species

  • Nitrosative stress: potential inhibition of Complex I activity by nitric oxide

  • pH variation: acidic microenvironments alter proton gradients affecting nuoK function

Experimental Methods to Study Environmental Effects:

  • Transcriptomics and proteomics to monitor nuoK expression levels across conditions

  • Membrane potential measurements using fluorescent probes to assess proton-pumping efficiency

  • Respirometry to quantify oxygen consumption rates

  • Metabolic flux analysis to determine pathway utilization

  • In vitro reconstitution in conditions mimicking different microenvironments

Understanding these variations is particularly important for B. bronchiseptica, which can persist in the respiratory tract for extended periods and must adapt to changing host environments . The bacterium's role in swine respiratory disease complexes suggests it can function across various microenvironmental conditions.

What are the challenges in developing antibodies specific to Bordetella bronchiseptica nuoK?

Developing antibodies specific to B. bronchiseptica nuoK presents several unique challenges:

Membrane Protein Antigenicity Issues:

  • Limited exposed epitopes due to nuoK's membrane-embedded nature

  • Conformational dependence on lipid environment making native structure difficult to maintain

  • Low immunogenicity of transmembrane regions which are often highly hydrophobic

  • Potential masking of nuoK epitopes by other Complex I subunits in the native complex

Antigen Preparation Challenges:

  • Maintaining proper folding of recombinant nuoK in detergent micelles or membrane mimetics

  • Avoiding aggregation of the purified protein during immunization

  • Selecting appropriate adjuvants compatible with membrane protein antigens

  • Determining whether to use full-length protein, specific peptides, or extramembrane domains

Specificity Considerations:

  • High sequence conservation between nuoK homologs across Bordetella species may limit B. bronchiseptica-specific antibody development

  • Cross-reactivity with host proteins needs to be thoroughly evaluated

  • Distinguishing between closely related proteins within the same respiratory complex

Technical Approaches to Address These Challenges:

  • Genetic immunization with DNA encoding nuoK to allow in vivo expression

  • Phage display technology to select antibodies against native conformations

  • Nanodiscs or proteoliposome presentation of nuoK to maintain native structure

  • Use of conformationally constrained peptides representing key epitopes

Successfully developed antibodies against nuoK would be valuable research tools for studying Complex I assembly, localization, and dynamics in B. bronchiseptica, particularly in the context of respiratory infections where this pathogen plays an important role .

What is the relationship between nuoK expression and antimicrobial resistance mechanisms?

The relationship between nuoK expression and antimicrobial resistance in B. bronchiseptica represents an important intersection between energy metabolism and drug resistance:

Energetic Requirements for Resistance:

  • Many active efflux pumps that export antibiotics require the proton motive force generated in part by Complex I

  • High-level expression of resistance determinants places energetic demands on the cell

  • B. bronchiseptica isolates harbor resistance genes like blaBOR (beta-lactamase), sul2 (sulfonamide resistance), and occasionally aph(3′′)-Ib (aminoglycoside resistance), all requiring energy for expression and function

Metabolic State and Resistance:

  • Alterations in electron transport chain activity via nuoK can affect bacterial growth rate

  • Slow-growing bacteria often exhibit phenotypic tolerance to many antibiotics regardless of specific resistance genes

  • Recent studies show B. bronchiseptica isolates are frequently resistant to beta-lactams, macrolides, and pleuromutilins

Experimental Approaches to Study This Relationship:

  • Transcriptomic analysis comparing wild-type and nuoK mutants exposed to antibiotics

  • Measurement of minimum inhibitory concentrations across different growth conditions

  • Assessment of efflux pump activity in strains with altered nuoK expression

  • Monitoring resistance gene expression in response to nuoK perturbation

The prevalence of antimicrobial resistance in B. bronchiseptica, particularly to beta-lactams through the blaBOR gene found in all examined isolates , makes understanding the connection between energy metabolism and resistance mechanisms particularly relevant for developing new therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.