Recombinant Bordetella bronchiseptica Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Putative Role in Fluoride Transport

CrcB is annotated as a putative fluoride ion transporter, though experimental validation in B. bronchiseptica remains limited. Homologs in other bacteria mitigate fluoride toxicity by exporting intracellular F⁻ ions .

Comparative Analysis with B. parapertussis CrcB

The B. parapertussis homolog (UniProt: A0A0H3N7F6) shares 87% sequence identity with B. bronchiseptica CrcB, suggesting conserved ion transport mechanisms .

FeatureB. bronchiseptica CrcBB. parapertussis CrcB
Length128 amino acids126 amino acids
Expression HostE. coliE. coli/Yeast/Baculovirus
ApplicationsResearch-onlyVaccine development (proposed)

Research Gaps and Future Directions

  1. Functional Validation: No direct studies on CrcB’s role in B. bronchiseptica virulence or fluoride resistance are available.

  2. Immunogenicity: Unlike outer membrane porins (e.g., PPP) or lipoproteins (e.g., PL) tested as vaccine candidates , CrcB has not been evaluated for protective immunity.

  3. Structural Studies: The NMR structure of a phage-related protein (NP_888769.1) in B. bronchiseptica highlights methodological frameworks that could be applied to CrcB.

Applications and Limitations

  • Research Use: Primarily employed in biochemical assays or structural studies .

  • Safety: Explicitly labeled "Not For Human Consumption" .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the protein according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
crcB; BB3275; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)
Target Names
crcB
Target Protein Sequence
MLTFAPLNFLAIGVGATLGAWLRWVLGLRLNGAGWPWGTLTANLVGGYLIGVMVALIASH PEWPAWIRLAAVTGFLGGLTTFSTFSAETVDMLERGVYATAAAYAGASLAGSLAMTGLGL ATVRLLLR
Uniprot No.

Target Background

Function
CrcB plays a crucial role in reducing fluoride concentration within cells, thereby mitigating its toxicity.
Database Links

KEGG: bbr:BB3275

STRING: 257310.BB3275

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the importance of studying the CrcB homolog in Bordetella bronchiseptica?

The CrcB homolog in Bordetella bronchiseptica is believed to function as a fluoride channel protein involved in ion transport across the bacterial membrane. Studying this protein is significant for understanding bacterial membrane physiology and potential resistance mechanisms. B. bronchiseptica serves as an ideal organism for studying pathogen-host interactions due to its natural ability to infect a wide variety of mammals, including laboratory models . This makes the CrcB homolog an interesting target for researchers exploring membrane protein function in this respiratory pathogen. Additionally, understanding the CrcB homolog could potentially contribute to developing novel diagnostic methods or therapeutic targets, similar to other B. bronchiseptica proteins that have shown promise as vaccine candidates .

What expression systems are recommended for recombinant B. bronchiseptica CrcB homolog production?

For recombinant expression of the B. bronchiseptica CrcB homolog, several bacterial expression systems can be employed with varying advantages:

E. coli-based expression systems:

  • BL21(DE3) strain with pET vector systems provides high-yield expression for initial characterization

  • C41(DE3) or C43(DE3) strains are recommended for membrane proteins like CrcB homolog

  • Cold-induction systems (using vectors like pColdII) can improve protein folding and solubility, as demonstrated with other B. bronchiseptica proteins

Methodology details:

  • Clone the crcB gene with appropriate tags (His or Strep tag) using PCR amplification from B. bronchiseptica genomic DNA

  • Design primers with restriction sites compatible with your chosen vector (HindIII works well for many B. bronchiseptica genes as shown in previous studies)

  • Optimize expression conditions (temperature, IPTG concentration, induction time)

  • Use detergents like DDM or LDAO for membrane protein extraction

Similar cloning approaches have been successfully used for other B. bronchiseptica proteins as demonstrated in the literature, where genes were amplified using specific primer sets and cloned into expression vectors using restriction sites or fusion cloning systems .

How can I verify successful expression and purification of recombinant CrcB homolog?

Verifying successful expression and purification of recombinant CrcB homolog requires multiple complementary approaches:

Western blot analysis:

  • Use anti-tag antibodies (anti-His or anti-Strep) for initial detection

  • Develop specific antibodies against CrcB homolog peptides for more specific detection

  • Include appropriate positive and negative controls

Mass spectrometry confirmation:

  • Tryptic digestion followed by LC-MS/MS analysis

  • Match peptide fragments against B. bronchiseptica protein database

  • Verify sequence coverage, particularly of key functional domains

When analyzing samples, prepare both whole-cell lysate (WCL) and purified protein samples for comparison, as demonstrated in studies with other B. bronchiseptica proteins . This approach allows detection of the protein at different stages of the purification process and can help troubleshoot expression or purification issues.

What purification strategies yield the highest purity for recombinant CrcB homolog?

The purification of membrane proteins like CrcB homolog requires specialized approaches:

Multi-step purification protocol:

  • Membrane fraction isolation using ultracentrifugation (100,000 × g, 1 hour)

  • Solubilization with appropriate detergents (DDM, LDAO, or Fos-choline-12)

  • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

  • Strep-Tactin affinity chromatography for Strep-tagged constructs (as used for other B. bronchiseptica proteins)

  • Size exclusion chromatography for final polishing and buffer exchange

Optimization considerations:

  • Detergent concentration is critical - too high can destabilize the protein, too low yields poor extraction

  • Buffer composition affects stability (pH, salt concentration, glycerol addition)

  • Addition of stabilizers (glycerol 10%, specific lipids) may maintain native conformation

Expected yields:

Expression SystemTypical Yield (mg/L culture)
E. coli BL21(DE3)0.5-2.0
E. coli C41(DE3)0.2-1.0
E. coli with pColdII0.3-1.5

How can I apply markerless genetic modification techniques to study CrcB homolog function in B. bronchiseptica?

The markerless allelic exchange method based on the B. subtilis sacB gene has proven effective for genetic manipulation in B. bronchiseptica and can be applied to study the CrcB homolog :

Step-by-step methodology:

  • Design constructs with ~1kb homologous regions flanking the crcB gene

  • Clone these regions into a suicide vector containing the sacB gene

  • Perform first homologous recombination (plasmid integration) by conjugation or electroporation

  • Screen for sucrose-sensitive clones carrying the integrated plasmid

  • Force second homologous recombination by growing cells on sucrose-containing media

  • Screen resulting colonies by PCR to identify those carrying the desired mutation

The entire procedure takes approximately 2 weeks and enables precise genome manipulations without leaving foreign DNA in the chromosome . This method can be used to create partial or complete gene knockouts, single-nucleotide mutations, or introduction of coding sequences for transcriptional fusions to study CrcB homolog function .

For B. bronchiseptica electroporation, specialized protocols have been developed that improve transformation efficiency, as detailed in the scientific literature .

What structural prediction tools are most reliable for modeling CrcB homolog structure?

Recent advances in protein structure prediction have revolutionized our ability to model proteins like the CrcB homolog:

AlphaFold2-based modeling:

  • AlphaFold2 with MMseqs2 (ColabFold) using default parameters has shown excellent results for membrane proteins

  • The predicted models can be further validated using the Dali server for structure-based protein homology searches

  • Primary, secondary, and tertiary structures can be visualized and compared with homologous proteins

Structural validation approaches:

  • Ramachandran plot analysis to verify backbone geometry

  • Assessment of membrane protein-specific parameters (hydrophobic thickness, charge distribution)

  • Molecular dynamics simulations to test model stability in membrane environments

Experimental validation:

  • Cysteine scanning mutagenesis to validate predicted transmembrane regions

  • Cross-linking experiments to verify predicted protein-protein interaction interfaces

  • Limited proteolysis to identify exposed regions versus buried domains

What functional assays can effectively characterize CrcB homolog transport activity?

As a putative fluoride channel, several approaches can characterize CrcB homolog function:

Fluoride transport assays:

  • Liposome-based fluoride efflux assay:

    • Reconstitute purified CrcB homolog into liposomes

    • Load liposomes with fluoride-sensitive probes (PBFI or fluoride-selective electrodes)

    • Measure fluoride transport kinetics across different conditions

  • Whole-cell fluoride sensitivity assays:

    • Compare growth of wild-type, CrcB knockout, and complemented strains in media with varying fluoride concentrations

    • Determine minimum inhibitory concentrations (MICs) for each strain

    • Quantify intracellular fluoride accumulation using fluoride-sensitive probes

Expected results for fluoride sensitivity:

Strain TypeExpected MIC (mM NaF)Growth in 5mM NaF (%)Intracellular F- Accumulation
Wild-type15-2585-95Low
ΔcrcB2-55-15High
Complemented10-2075-85Moderate

These functional assays can be combined with site-directed mutagenesis of predicted key residues to map the functional domains of the CrcB homolog.

How can transcriptional regulation of the crcB gene be characterized in B. bronchiseptica?

Understanding transcriptional regulation requires several complementary approaches:

Quantitative RT-PCR methodology:

  • Prepare total RNA from B. bronchiseptica cultures using established protocols (Trizol Max Bacterial RNA isolation Kit, RNeasy Mini Kit, and RNase-free DNase)

  • Perform reverse transcription using high-quality cDNA synthesis kits

  • Design primers specific to crcB and control genes (recA is commonly used as an internal control)

  • Quantify relative expression under different conditions

  • Normalize data to internal controls and calculate fold changes

Promoter fusion studies:

  • Clone the putative crcB promoter region into reporter vectors containing promoterless luxCDABE operon, similar to approaches used for other B. bronchiseptica genes

  • Introduce these constructs into B. bronchiseptica via homologous recombination

  • Measure reporter activity under various environmental conditions (pH, temperature, nutrient availability)

  • Map the minimal promoter region through systematic deletions

These approaches can reveal how crcB expression changes in response to environmental fluoride levels and other stressors, providing insights into its physiological role.

What are effective approaches to study protein-protein interactions involving the CrcB homolog?

Understanding the interaction partners of CrcB homolog requires specialized techniques for membrane proteins:

Co-immunoprecipitation with membrane cross-linking:

  • Treat bacterial cells with membrane-permeable cross-linkers

  • Solubilize membranes under gentle conditions

  • Perform pull-down assays using antibodies against CrcB or attached epitope tags

  • Identify interaction partners by mass spectrometry

Bacterial two-hybrid systems for membrane proteins:

  • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system is suitable for membrane protein interactions

  • Clone crcB and potential interaction partners into appropriate vectors

  • Screen for positive interactions via reporter gene activation

  • Validate interactions using independent methods

In vivo proximity labeling:

  • Express CrcB homolog fused to BioID or APEX2 proximity labeling enzymes

  • Allow in vivo biotinylation of proximal proteins

  • Purify biotinylated proteins using streptavidin affinity chromatography

  • Identify labeled proteins by mass spectrometry

These approaches can reveal both stable and transient interaction partners, providing insights into the functional complexes involving CrcB homolog.

What strategies can overcome poor expression yields of recombinant CrcB homolog?

Low expression yields of membrane proteins like CrcB homolog are common but can be addressed through systematic optimization:

Expression optimization strategy:

  • Screen multiple E. coli strains specifically designed for membrane proteins (C41, C43, Lemo21)

  • Test different induction parameters (temperature reduction to 16-18°C, lower IPTG concentrations 0.1-0.5mM)

  • Include membrane protein-specific additives (glycerol 10%, specific lipids, mild detergents in culture)

  • Try fusion partners that enhance membrane protein expression (Mistic, SUMO)

Codon optimization considerations:

  • Analyze rare codon usage in the crcB gene sequence

  • Consider synthetic gene synthesis with codon optimization for E. coli

  • Co-express rare tRNAs using the pRARE plasmid system

These approaches have successfully improved expression of challenging membrane proteins in multiple studies and can be adapted for CrcB homolog expression.

How can I troubleshoot unsuccessful genetic modification attempts in B. bronchiseptica?

When genetic modifications of B. bronchiseptica fail, several troubleshooting approaches can help:

Common issues and solutions:

  • Poor conjugation efficiency:

    • Optimize donor:recipient ratio (typically 1:10 works well)

    • Ensure fresh, early-log phase cultures for both strains

    • Try alternative mating protocols (liquid vs. solid media)

  • Failed homologous recombination:

    • Increase homology arm length (aim for >1kb on each side)

    • Check sequence accuracy of homology regions

    • Ensure suicide vector is properly maintained in donor strain

  • Sucrose counter-selection issues:

    • Verify sacB gene functionality in your vector

    • Optimize sucrose concentration (typically 5-10%)

    • Test different media formulations for counter-selection

The markerless allelic exchange protocol based on the sacB gene has been successfully applied in B. bronchiseptica for various genetic modifications , but troubleshooting may be required for challenging genes.

What approaches can resolve inconsistent functional assay results with CrcB homolog?

Inconsistent functional assay results are common when working with membrane proteins and can be addressed through careful optimization:

Systematic troubleshooting:

  • Protein quality issues:

    • Verify protein integrity by SDS-PAGE and Western blot

    • Check for aggregation using size exclusion chromatography

    • Optimize detergent choice and concentration for reconstitution

  • Liposome reconstitution variables:

    • Standardize lipid composition (consider native B. bronchiseptica membrane lipids)

    • Control protein:lipid ratio precisely

    • Verify successful reconstitution by freeze-fracture electron microscopy

  • Assay optimization:

    • Calibrate fluoride probes under your specific conditions

    • Test multiple buffer systems to identify optimal conditions

    • Include positive controls (known fluoride transporters) in parallel assays

These systematic approaches can help identify sources of variability and establish reliable functional assay protocols.

How can structural studies of CrcB homolog contribute to understanding bacterial fluoride resistance?

Structural characterization of CrcB homolog presents both challenges and opportunities:

Advanced structural approaches:

  • Cryo-EM for membrane protein structure:

    • Purify CrcB homolog in appropriate detergents or nanodiscs

    • Screen grid conditions and vitrification parameters

    • Aim for resolution below 4Å to resolve transmembrane helices

  • X-ray crystallography optimization:

    • Screen detergents specifically suited for crystallization

    • Try lipidic cubic phase (LCP) crystallization methods

    • Consider fusion partners that promote crystallization (T4 lysozyme, BRIL)

The structural information gained can reveal the fluoride selectivity mechanism, conformational changes during transport, and potential drug-binding sites. This knowledge could contribute to developing novel antimicrobials targeting ion transport in B. bronchiseptica.

What potential biotechnological applications exist for recombinant CrcB homolog?

The unique properties of CrcB homolog suggest several potential applications:

Biotechnology applications:

  • Biosensor development:

    • Engineer CrcB-based fluoride biosensors for environmental monitoring

    • Develop whole-cell biosensors using crcB promoter fusions to reporter genes

    • Create fluoride-responsive genetic circuits for synthetic biology applications

  • Bioremediation applications:

    • Engineer bacteria with enhanced fluoride sequestration capabilities

    • Develop biofilters using recombinant CrcB expression systems

    • Design encapsulated cell systems for environmental fluoride removal

These applications represent the translational potential of basic research on the CrcB homolog, similar to how other B. bronchiseptica proteins have shown potential for diagnostic and vaccine development .

How might CrcB homolog function relate to B. bronchiseptica pathogenesis?

The connection between CrcB homolog and bacterial pathogenesis remains to be fully explored:

Research approaches:

  • Infection models with crcB mutants:

    • Generate markerless crcB deletion mutants using established protocols

    • Test virulence in appropriate animal models

    • Assess colonization, persistence, and host immune response

  • Transcriptomic studies during infection:

    • Compare crcB expression between in vitro and in vivo conditions

    • Identify co-regulated genes during infection

    • Map regulatory networks involving crcB

Understanding how fluoride resistance and ion homeostasis contribute to B. bronchiseptica pathogenesis could reveal new therapeutic targets. While PPP and PL proteins have already shown immune-protective potential as vaccine candidates , the role of CrcB homolog in pathogenesis and potential as a therapeutic target remains to be explored.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.