Recombinant Bordetella bronchiseptica Type IV secretion system protein ptlB homolog (ptlB)

Shipped with Ice Packs
In Stock

Description

Recombinant Bordetella bronchiseptica Type IV Secretion System Protein PtlB Homolog: Definition and Role

The Recombinant Bordetella bronchiseptica Type IV Secretion System (T4SS) Protein PtlB Homolog (ptlB) is a recombinant form of the ptlB gene product, which is a core component of the T4SS in Bordetella species. This system is critical for the secretion of pertussis toxin (PTX) in B. pertussis, though B. bronchiseptica and B. parapertussis harbor homologs of T4SS genes but do not naturally produce active PTX under standard conditions .

Key Features of PtlB:

  • Function: PtlB is part of the ptlABCDEFGHI operon, which encodes the T4SS machinery. It is homologous to components of the Agrobacterium tumefaciens VirB system and Bordetella pertussis Ptl system .

  • Structure: PtlB is a membrane-associated protein that likely facilitates toxin assembly or pilus formation in the T4SS .

  • Expression: Native B. bronchiseptica strains (e.g., RB50) retain ptlB but lack regulatory elements (e.g., active promoters) required for PTX expression. Recombinant expression systems (e.g., E. coli) are used to produce PtlB for research .

Role in PTX Secretion

PtlB is essential for the secretion of PTX in engineered B. bronchiseptica strains. Studies demonstrate that introducing the ptx-ptl operon (including ptlB) from B. pertussis into B. bronchiseptica enables PTX production and secretion .

Table 1: Experimental Data on PtlB-Dependent PTX Secretion

ParameterB. bronchiseptica Bb55::pSZH5 (ptlB+)Control (ptlB–)
PTX in supernatant (µg/mL)5.00.08
PTX in cell lysate (µg/mL)0.080.00
CHO cell cluster assayActive PTX detectedNo activity

Source:

Evolutionary and Species-Specific Variations

  • Phylogenetic Diversity: T4SS loci in B. bronchiseptica (e.g., D445) exhibit distinct evolutionary trajectories compared to B. pertussis, with some strains missing ptlB or other T4SS components .

  • Host Adaptation: B. bronchiseptica hypervirulent strains (e.g., complex IV) may compensate for reduced T4SS activity via enhanced T3SS effector expression, such as BteA .

Vaccine Candidate Potential

While PtlB itself has not been directly tested as a vaccine antigen, its role in T4SS-mediated virulence makes it a candidate for subunit vaccine development. For example:

  • Immune Targeting: Recombinant PtlB could elicit antibodies against T4SS components, disrupting toxin secretion .

  • Cross-Species Protection: B. bronchiseptica PtlB shares ~70% sequence identity with B. pertussis PtlB, suggesting potential for broad-spectrum immunogenicity .

Table 2: Comparative Analysis of Bordetella T4SS Components

ComponentB. pertussisB. bronchisepticaB. parapertussis
PtlAPresentPresent (homolog)Present (homolog)
PtlBPresentPresent (homolog)Present (homolog)
PtlGPresentAbsentAbsent
PTXActiveInactiveInactive

Source:

Challenges and Limitations

  • Functional Redundancy: T4SS-independent virulence mechanisms (e.g., T3SS effectors like BteA) may reduce reliance on PtlB in B. bronchiseptica .

  • Lability Issues: PTX produced by engineered B. bronchiseptica strains is less stable than native B. pertussis PTX, potentially limiting therapeutic applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ptlB; BB4896; Type IV secretion system protein PtlB homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)
Target Names
ptlB
Target Protein Sequence
MRDPLFKGCTRPAMLMGVPATPLAVCSGTIALLGIWFSIAFLALFPVALLAMRIMIRRDD QQFRLIWLYLRMRWLSRDRTHAFWQSTVYAPLRYAERRQRLRKP
Uniprot No.

Target Background

Database Links

KEGG: bbr:BB4896

STRING: 257310.BB4896

Protein Families
VirB3 family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the PtlB protein and what is its role in Bordetella bronchiseptica?

PtlB is a protein component of the Type IV secretion system (T4SS) in Bordetella bronchiseptica. It functions as part of the ptl (pertussis toxin liberation) gene cluster, which encodes proteins essential for the secretion of pertussis toxin. Within this secretion machinery, PtlB likely contributes to the formation of the secretion channel that spans the bacterial cell envelope, facilitating the export of pertussis toxin from the bacterial cell to the extracellular environment. Research has demonstrated that B. bronchiseptica contains all essential ptl genes necessary for toxin secretion, and when provided with a functional promoter, can efficiently produce and secrete biologically active pertussis toxin .

How does the structure of PtlB relate to its function in the Type IV secretion system?

The PtlB protein is structurally similar to components found in other Type IV secretion systems. Based on analysis of related T4SS structures, PtlB likely contributes to the inner membrane complex (IMC) of the secretion apparatus. T4SS structures typically consist of an outer membrane core complex (OMCC) connected by a thin stalk to the IMC. The IMC exhibits high symmetry, often displaying 6-fold symmetry with a hexameric collar in the periplasm and a cytoplasmic complex composed of hexamers of ATPase dimers . These structural features are essential for creating a continuous secretion channel that spans the cell envelope, allowing for the transport of pertussis toxin from the cytoplasm to the extracellular environment. Understanding PtlB's exact position and structural contributions to this machinery requires further research using techniques such as cryo-electron tomography and structural biology approaches.

How is the ptlB gene organized within the Bordetella genome?

The ptlB gene is part of the ptx-ptl operon in Bordetella species. This operon encodes both the pertussis toxin subunits (ptx genes) and the secretion apparatus proteins (ptl genes) necessary for toxin export. In B. bronchiseptica, the ptx-ptl operon remains intact and potentially functional, though typically unexpressed due to mutations in the promoter region. The organization of this operon is critical for the coordinated expression of toxin and secretion machinery components. Research has shown that B. bronchiseptica contains the complete set of ptl genes, including ptlB, alongside the ptx genes, enabling toxin production and secretion when supplied with a functional promoter . This genetic organization ensures that when conditions permit expression, both the toxin and its dedicated secretion system are produced simultaneously.

What factors regulate ptlB expression in wild-type B. bronchiseptica?

In wild-type B. bronchiseptica, ptlB expression is primarily regulated at the transcriptional level through the control of the ptx promoter. The ptx promoter in B. bronchiseptica contains several single nucleotide polymorphisms (SNPs) compared to the B. pertussis promoter, which significantly reduce its activity . Additionally, expression is controlled by the BvgAS two-component regulatory system, which responds to environmental signals to regulate virulence gene expression. Under standard laboratory conditions, the ptx-ptl operon in B. bronchiseptica shows minimal expression due to these promoter mutations. Comparative studies have demonstrated that the B. pertussis ptx promoter shows more than 100-fold higher activity than its B. bronchiseptica counterpart when tested in either species background . This regulatory difference explains why B. pertussis readily produces pertussis toxin while B. bronchiseptica typically does not, despite possessing the necessary genes.

What are the optimal conditions for recombinant expression of PtlB protein?

For optimal recombinant expression of PtlB protein, researchers should consider using an E. coli expression system with a pET vector (e.g., pET28a) containing a thrombin-cleavable N-terminal hexahistidine tag. Based on approaches used for similar Bordetella proteins, expression should be induced in BL21(DE3) cells at mid-log phase (OD600 ~0.6-0.8) with 0.5-1.0 mM IPTG, followed by incubation at 18-20°C for 16-18 hours to minimize inclusion body formation . Since membrane proteins can be difficult to express, adding glycerol (5-10%) to the growth medium may improve protein folding and stability. As PtlB is likely a membrane-associated protein, it's advisable to extract it using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS at concentrations just above their critical micelle concentration. Expression constructs should be designed to exclude the predicted signal sequence (similar to the approach used for BpsB, where the first 26 amino acids were excluded) .

What purification strategy yields the highest purity and activity of recombinant PtlB?

A multi-step purification strategy is recommended for obtaining high-purity, active recombinant PtlB. Based on successful approaches with similar bacterial secretion proteins, the following protocol is advised: Begin with immobilized metal affinity chromatography (IMAC) using Ni-NTA resin, with binding in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and an appropriate detergent (e.g., 0.03% DDM). Include 20-40 mM imidazole in the binding buffer to reduce non-specific binding, and elute with a 50-300 mM imidazole gradient. For applications requiring tag removal, incubate with thrombin followed by a second Ni-NTA step to remove uncleaved protein. Further purify using size exclusion chromatography (e.g., Superdex 200) in a buffer containing 20 mM Tris-HCl pH 7.5, 150 mM NaCl, and detergent at a concentration above CMC . Throughout purification, maintain sample temperature at 4°C and include protease inhibitors to prevent degradation. Verify protein purity using SDS-PAGE and Western blotting with anti-His antibodies or custom antibodies against PtlB.

What assays can be used to evaluate the functionality of recombinant PtlB in vitro?

Several complementary assays can be employed to evaluate recombinant PtlB functionality in vitro. First, ATPase activity assays should be considered if PtlB possesses predicted ATPase domains, using colorimetric methods to measure inorganic phosphate release. Second, protein-protein interaction assays such as pull-down experiments with other Ptl proteins can assess PtlB's ability to form the necessary complexes for secretion apparatus assembly. Third, reconstitution of PtlB into liposomes followed by membrane permeability assays could evaluate its channel-forming abilities. Fourth, in vitro assembly assays combining purified components of the T4SS might reveal PtlB's contribution to complex formation, which could be visualized by negative-stain electron microscopy . Additionally, structural stability can be assessed using thermal shift assays (Thermofluor) to determine if the recombinant protein is properly folded. For full functional assessment, complementation experiments in ptlB-deficient Bordetella strains should be performed to test if the recombinant protein can restore pertussis toxin secretion, measured by ELISA or Chinese hamster ovary (CHO) cell clustering assays that detect biologically active toxin .

How can one monitor the interaction between PtlB and other components of the Type IV secretion system?

Monitoring interactions between PtlB and other T4SS components requires a multi-technique approach. Co-immunoprecipitation experiments using antibodies against PtlB or epitope-tagged versions of the protein can identify interaction partners from bacterial lysates. For more quantitative measurements, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can determine binding affinities between purified PtlB and other Ptl proteins. Bacterial two-hybrid or yeast two-hybrid systems are useful for screening potential interactions in vivo. Advanced microscopy techniques such as Förster resonance energy transfer (FRET) with fluorescently labeled proteins can visualize interactions in real-time . Cross-linking mass spectrometry (XL-MS) can identify specific residues involved in protein-protein interfaces. For structural characterization of the entire complex, cryo-electron tomography has proven effective for visualizing T4SS assemblies in situ, revealing the architectural arrangement of components like PtlB within the secretion apparatus . Finally, complementation studies using chimeric proteins or site-directed mutants can validate the functional significance of identified interactions in vivo by assessing their impact on pertussis toxin secretion.

How does PtlB contribute to the efficient secretion of pertussis toxin?

PtlB likely makes several critical contributions to pertussis toxin secretion efficiency. As a component of the Type IV secretion system, PtlB probably functions in the assembly of the secretion channel that spans the cell envelope. Research on T4SS structures indicates that proteins like PtlB form part of the inner membrane complex (IMC), which exhibits highly symmetrical organization critical for toxin transport . PtlB may participate in the recognition of pertussis toxin subunits and facilitate their translocation through the secretion apparatus. The functional significance of PtlB can be investigated through deletion studies in recombinant B. bronchiseptica strains engineered to express pertussis toxin. Such studies have demonstrated that when B. bronchiseptica is provided with a functional promoter upstream of the ptx-ptl region, it produces and efficiently secretes biologically active pertussis toxin, indicating that all essential ptl genes, including ptlB, are functional . Additionally, PtlB may contribute to the energetics of toxin secretion, potentially through ATPase activity or by interacting with energy-providing components of the secretion system.

What structural modifications to PtlB could enhance its function in a recombinant expression system?

Strategic structural modifications to PtlB could potentially enhance its functionality in recombinant expression systems. First, researchers should consider optimizing the N-terminus by removing the native signal sequence and replacing it with a more efficient one for the expression host, similar to the approach used with BpsB where variations of N-terminal truncations (residues 27-311 or 35-311) were tested . Second, introducing a C-terminal FLAG or His tag facilitates purification while minimizing interference with function, as demonstrated in complementation studies with BpsB-FLAG that successfully restored biofilm formation in deletion mutants . Third, stabilizing mutations at cysteine residues (e.g., C48S in BpsB) could reduce aggregation through prevention of non-native disulfide bonds . Fourth, engineering enhanced metal-binding sites could improve stability, particularly if PtlB has metal-dependent functional domains. Fifth, modifying hydrophobic transmembrane regions might improve solubility while maintaining structure-function relationships. These modifications should be systematically evaluated through activity assays and complementation studies in ptlB-deficient strains to confirm that enhanced expression does not compromise native function.

What are the major challenges in studying PtlB function and how can they be overcome?

Studying PtlB function presents several significant challenges that require strategic approaches to overcome. First, as a likely membrane-associated protein, PtlB may be difficult to express and purify in a native conformation. This can be addressed by using specialized expression systems designed for membrane proteins, such as C41/C43(DE3) E. coli strains, and optimizing detergent conditions during purification . Second, the natural low expression levels of the ptx-ptl operon in B. bronchiseptica make native studies challenging. Researchers can overcome this by using engineered strains with active promoters placed upstream of the ptx-ptl region, as demonstrated in previous studies . Third, the complex multi-protein nature of the T4SS makes it difficult to isolate the specific contribution of PtlB. This can be addressed through complementation studies with specific ptlB mutations combined with sensitive toxin secretion assays. Fourth, the lack of high-resolution structural information for PtlB limits mechanistic understanding. Researchers should consider applying cryo-electron tomography to visualize the entire T4SS apparatus in situ, as successfully used for other secretion systems . Finally, the technical difficulties in measuring protein translocation through the secretion channel can be overcome by developing fluorescently labeled toxin substrates to track secretion in real-time.

How does PtlB from B. bronchiseptica compare to homologs in other bacterial species?

PtlB from B. bronchiseptica shares significant homology with components of Type IV secretion systems found in other bacterial species. Comparative genomic analysis reveals that the ptl system in Bordetella species is most closely related to the VirB system of Agrobacterium tumefaciens and conjugation systems like the Tra system encoded by the pKM101 plasmid . The structure of these T4SS systems typically includes an outer membrane core complex connected by a thin stalk to an inner membrane complex with distinctive symmetry features . While the precise sequence identity percentages vary across different homologs, the functional domains responsible for protein-protein interactions and channel formation are generally conserved. Despite this conservation, there are species-specific adaptations that likely reflect the specialized role of PtlB in pertussis toxin secretion rather than DNA transfer (the more common function of T4SS). Interestingly, while B. bronchiseptica, B. pertussis, and B. parapertussis all contain the ptx-ptl genes, only B. pertussis regularly expresses them due to promoter differences, suggesting evolutionary divergence in the regulation of these systems .

What insights can be gained from studying PtlB homologs in other secretion systems?

Studying PtlB homologs in other secretion systems provides valuable insights into both common mechanisms and specialized adaptations. Analysis of well-characterized T4SS components from systems like the pKM101-encoded complex reveals that these systems typically consist of an outer membrane core complex with 14-fold symmetry connected to an inner membrane complex with 6-fold symmetry . These structural principles likely apply to the Ptl system as well. Research on the VirB system from A. tumefaciens, which has been more extensively characterized, can inform hypotheses about PtlB function, particularly regarding its position in the secretion apparatus and interaction partners. Notably, while most T4SS transport DNA, the Ptl system is specialized for protein secretion, making it an interesting evolutionary case study in functional adaptation. Comparative biochemical studies of PtlB with homologs that have ATPase activity can determine whether PtlB retains this function or has evolved alternative mechanisms for energizing toxin transport. Additionally, understanding how homologous systems recognize and transport their substrates may inform strategies for engineering the Ptl system for biotechnology applications such as protein delivery systems.

How does PtlB contribute to Bordetella virulence and pathogenesis?

PtlB contributes to Bordetella virulence primarily through its essential role in the secretion of pertussis toxin, a major virulence factor. Although B. bronchiseptica typically does not express pertussis toxin due to promoter mutations, research has demonstrated that when provided with a functional promoter, B. bronchiseptica can produce and efficiently secrete biologically active pertussis toxin, indicating that all components of the secretion apparatus, including PtlB, are functionally intact . The toxin secreted by engineered B. bronchiseptica strains has been shown to be neutralized by pertussis vaccine-induced antibodies, confirming its immunological similarity to B. pertussis toxin . In B. pertussis, pertussis toxin plays multiple roles in pathogenesis, including suppression of host immune responses through inhibition of G-protein signaling pathways, which facilitates respiratory tract colonization. By enabling the secretion of this toxin, PtlB indirectly contributes to these virulence mechanisms. Understanding PtlB function provides insight into a specialized protein secretion system that has evolved specifically for toxin export rather than the more common DNA transfer function of most Type IV secretion systems .

Could recombinant PtlB be utilized for developing novel vaccine strategies or diagnostic tools?

Recombinant PtlB holds significant potential for developing novel vaccine strategies and diagnostic tools. As a component of the pertussis toxin secretion apparatus, PtlB represents a conserved target that could provide broader protection against multiple Bordetella species. A multi-component vaccine incorporating both toxin subunits and secretion apparatus proteins might generate more comprehensive immunity against diverse bacterial mechanisms. For diagnostic applications, detecting antibodies against PtlB could potentially distinguish between vaccine-induced immunity (which typically generates responses only to toxin components) and natural infection (which might induce antibodies against both toxin and secretion components). Additionally, understanding PtlB structure and function could enable the development of inhibitors targeting the secretion system as novel therapeutic agents. The potential for engineering the Ptl secretion system for delivering heterologous proteins also presents opportunities for vaccine development, where modified Bordetella strains could deliver protective antigens from other pathogens. Research has already established that B. bronchiseptica can secrete active pertussis toxin when provided with a functional promoter , suggesting that the secretion apparatus could potentially be adapted for other protein substrates.

Table 5.1: Comparison of ptx-ptl Operons Across Bordetella Species

Speciesptx Genesptl GenesPromoter ActivityPT ProductionPT Secretion
B. pertussisCompleteCompleteHighYesEfficient
B. bronchisepticaCompleteCompleteVery low*No*No*
B. parapertussisCompletePartialVery low*No*No*

*Under natural conditions; when provided with a functional promoter, B. bronchiseptica can produce and secrete active pertussis toxin .

How do mutations in the Bordetella bronchiseptica ptx promoter affect PtlB expression?

Mutations in the B. bronchiseptica ptx promoter significantly impact PtlB expression by reducing transcription of the entire ptx-ptl operon. Research has identified four single-basepair mutations in the ptx promoter of B. bronchiseptica compared to the B. pertussis promoter . These mutations have a dramatic effect on promoter activity, with studies demonstrating that the B. pertussis ptx promoter shows more than 100-fold higher activity than its B. bronchiseptica counterpart when tested in either species background . This substantial difference in promoter activity explains why B. bronchiseptica does not naturally produce pertussis toxin despite containing all the necessary genes. The reduced promoter activity affects the expression of all genes in the operon, including ptlB and other ptl genes required for the secretion apparatus. Importantly, when the ptx-ptl operon is placed under control of an active promoter in B. bronchiseptica, the bacterium successfully produces and secretes biologically active pertussis toxin, confirming that the ptl genes including ptlB are functionally intact and capable of assembling a complete secretion system when expressed .

Table 5.2: Recommended Cloning and Expression Strategies for Recombinant PtlB

ParameterRecommendationNotes
Expression VectorpET28a or similarProvides N-terminal His-tag with thrombin cleavage site
Host StrainE. coli BL21(DE3) or C41/C43(DE3)C41/C43 better for membrane proteins
Induction Conditions0.5 mM IPTG, 18°C, 16-18 hoursLower temperature reduces inclusion body formation
Lysis Buffer50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 0.03% DDMDetergent critical for membrane protein solubilization
Purification MethodNi-NTA followed by Size ExclusionTwo-step purification recommended for high purity
Storage Conditions20 mM Tris-HCl pH 7.5, 150 mM NaCl, detergent, 10% glycerol, -80°CAvoid freeze-thaw cycles

What genetic complementation approaches are most effective for studying PtlB function?

The most effective genetic complementation approaches for studying PtlB function utilize plasmid-based expression systems that allow precise control over protein production. Based on successful complementation studies with related Bordetella proteins, researchers should consider the following strategy: First, amplify the complete ptlB gene including approximately 20-30 bp upstream of the translational start site and 30 bp downstream of the termination codon from B. bronchiseptica genomic DNA . Second, clone this fragment into a broad-host-range vector such as pBBR1MCS, which has been successfully used for complementation in Bordetella species . Third, transform this construct into a B. bronchiseptica ΔptlB strain to test for restoration of pertussis toxin secretion. For more controlled expression, the ptlB gene can be placed under an inducible promoter. To facilitate protein detection and localization studies, C-terminal epitope tags such as FLAG can be added, as this approach has been successful with other Bordetella proteins without disrupting function . The complementation can be verified by Western blot analysis to confirm protein expression and by toxin secretion assays such as ELISA or CHO cell clustering assays to assess functional restoration. This systematic approach allows researchers to establish causality between ptlB expression and phenotypic outcomes.

What are the most pressing unanswered questions about PtlB and the Type IV secretion system in Bordetella?

Several critical knowledge gaps remain in our understanding of PtlB and the Type IV secretion system in Bordetella species. First, the high-resolution structure of PtlB and its precise arrangement within the secretion apparatus remains undetermined, limiting our mechanistic understanding of toxin transport. Second, the specific protein-protein interactions between PtlB and other components of the secretion system are poorly characterized, particularly regarding how these interactions contribute to channel assembly and stability. Third, the energetics of toxin secretion through the Ptl system are not fully understood, including whether PtlB plays a direct role in energy transduction. Fourth, the substrate recognition mechanism by which the secretion apparatus specifically identifies pertussis toxin components for export remains unclear. Fifth, the evolutionary relationship between the Ptl system and other T4SS needs further exploration, particularly regarding how this machinery adapted from DNA transfer to protein secretion. Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and computational modeling. Techniques such as cryo-electron tomography have proven valuable for visualizing T4SS complexes in situ and could provide critical insights into the architecture of the Ptl system and PtlB's position within it.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.