Recombinant Bordetella bronchiseptica Type IV secretion system protein ptlE homolog (ptlE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
ptlE; BB4899; Type IV secretion system protein PtlE homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)
Target Names
ptlE
Target Protein Sequence
MPDPRPLTPDQTHGRGHAEAAVDWEASRLYRLAQSERRAWTVAWAALAVTALSLIAIATM LPLKTTIPYLIEVEKSSGAASVVTQFEPRDFTPDTLMNQYWLTRYVAARERYDWHTIQHD YDYVRLLSAPAVRHDYETSYEAPDAPDRKYGAGTTLAVKILSAIDHGKGVGTVRFVRTRR DADGQGAAESSIWVATVAFAYDRPRALTQAQRWLNPLGFAVTSYRVDAEAGQP
Uniprot No.

Target Background

Database Links

KEGG: bbr:BB4899

STRING: 257310.BB4899

Protein Families
VirB8 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the PtlE protein and what is its role in bacterial secretion systems?

PtlE is a component of the type IV secretion system (T4SS) found in Bordetella species. It functions as a peptidoglycanase responsible for the local removal or rearrangement of the peptidoglycan layer during the assembly of the pertussis toxin (Ptl) secretion complex. The protein plays a critical role in facilitating the transport of large folded molecules through the periplasm by modifying the peptidoglycan layer, which otherwise would act as a barrier. In Bordetella pertussis, PtlE is encoded by one of the nine ptl (pertussis toxin liberation) genes that collectively form a secretion apparatus spanning both the inner and outer bacterial membranes .

The secretion complex formed by these proteins enables the export of pertussis toxin, a critical virulence factor. When mutations are introduced at the active site residues of PtlE (specifically aspartic acid at position 53 and glutamic acid at position 62), the peptidoglycanase activity is abolished, and consequently, B. pertussis strains carrying these mutations exhibit deficient pertussis toxin secretion .

How does PtlE's peptidoglycanase activity facilitate toxin secretion?

The peptidoglycan layer in bacterial cell walls presents a significant barrier for the transport of large folded molecules like assembled pertussis toxin and secretion component proteins (PtlC through PtlH), as these molecules are too large to diffuse through intact peptidoglycan. PtlE addresses this challenge through its peptidoglycanase activity, which enables the local modification of the peptidoglycan mesh .

Methodologically, this activity can be demonstrated using activity gels containing Micrococcus lysodeikticus cells as a source of peptidoglycan. Following electrophoresis and protein renaturation, peptidoglycanase activity appears as uncolored bands against a methylene blue-stained background. Through this approach, researchers have confirmed that PtlE exhibits peptidoglycanase activity, while mutant versions with alanine substitutions at the putative active site residues lack this enzymatic function .

This localized peptidoglycan modification allows the assembly and anchoring of the secretion complex through the cell envelope, creating a continuous channel for toxin export. In B. pertussis strains carrying mutations in the active site residues of PtlE, the peptidoglycanase activity is abolished, resulting in deficient pertussis toxin secretion, thereby confirming the enzyme's essential role in the secretion process .

What experimental approaches are optimal for assessing PtlE peptidoglycanase activity in vitro?

For rigorous assessment of PtlE peptidoglycanase activity in vitro, a multifaceted approach combining several complementary methodologies is recommended:

Activity Gel Assays: The gold standard method involves incorporating Micrococcus lysodeikticus cells as a peptidoglycan source in SDS-PAGE gels. After electrophoresis, the protein is allowed to renature, and peptidoglycanase activity is visualized as clearing zones (uncolored bands) against a methylene blue-stained background. This approach offers visual confirmation of enzymatic activity and approximate molecular weight determination simultaneously .

Turbidimetric Assays: A quantitative complement to activity gels involves measuring the decrease in turbidity of a peptidoglycan suspension over time. This can be performed by:

  • Preparing a suspension of purified peptidoglycan at approximately 0.5 mg/ml in an appropriate buffer (pH 7.0-7.5)

  • Adding purified recombinant PtlE at various concentrations

  • Monitoring the decrease in absorbance at 600 nm at regular intervals

  • Calculating enzyme activity based on the rate of turbidity reduction

Site-Directed Mutagenesis Studies: To conclusively establish structure-function relationships, systematic mutagenesis of conserved residues, particularly focusing on the catalytic domain (including aspartic acid at position 53 and glutamic acid at position 62), should be performed, followed by activity assays of the purified mutant proteins .

Fluorescently-Labeled Peptidoglycan Substrates: For increased sensitivity, peptidoglycan labeled with fluorescent dyes that exhibit fluorescence quenching when incorporated into intact peptidoglycan can be utilized. Enzymatic hydrolysis results in measurable fluorescence increases, providing a sensitive readout of enzyme activity.

MethodAdvantagesLimitationsKey Parameters
Activity GelsVisual confirmation; molecular weight dataSemi-quantitative; time-consuming0.1-0.2% M. lysodeikticus cells; pH 6.5-7.5 buffer for renaturation
Turbidimetric AssaysQuantitative; real-time kineticsLess sensitive; affected by protein aggregation0.5 mg/ml peptidoglycan; absorbance at 600 nm
Site-Directed MutagenesisPrecise structure-function insightsLabor-intensive; indirect evidenceFocus on D53 and E62 residues
Fluorescent SubstratesHigh sensitivity; amenable to high-throughputExpensive; may alter substrate propertiesExcitation/emission wavelengths specific to chosen fluorophore

How does the PtlE protein interact with other components of the type IV secretion system?

The integration of PtlE within the T4SS complex involves sophisticated interactions with multiple protein components to form a functional secretion apparatus. Based on structural and functional studies of T4SS complexes, the following interaction patterns can be inferred:

Core Complex Assembly: PtlE likely contributes to the ring-shaped core complex structure characteristic of T4SS systems. In analogous systems like the one in Legionella pneumophila, the core complex spans both inner and outer membranes. Analysis of premature complexes suggests a sequential assembly mechanism where channel components dock into an outer-membrane subcomplex .

Protein-Protein Interaction Mapping: To methodologically investigate PtlE interactions, researchers can employ:

  • Bacterial Two-Hybrid Assays: By creating fusion constructs of PtlE and other Ptl proteins with complementary fragments of adenylate cyclase or similar reporter systems, direct protein-protein interactions can be detected through reporter gene activation.

  • Co-Immunoprecipitation Studies: Using antibodies against PtlE or its epitope tags to pull down protein complexes, followed by mass spectrometry or Western blotting to identify interaction partners.

  • Cross-Linking Mass Spectrometry: Chemical cross-linkers can be used to capture transient interactions, followed by digestion and mass spectrometry analysis to identify crosslinked peptides, providing spatial constraints for protein-protein interfaces.

The PtlE protein likely forms functional interactions with several other Ptl proteins, including PtlC, PtlD, PtlF, PtlG, and PtlH, as these are believed to collectively form the secretion complex spanning both inner and outer membranes. Experimental evidence from the related Bordetella species indicates that PtlE works in concert with these proteins to enable toxin secretion .

What are the structural differences between PtlE homologs across Bordetella species and how do they affect function?

Comparative analysis of PtlE homologs across different Bordetella species reveals both conserved features and species-specific variations that may influence functional properties:

Cross-Species Conservation Analysis: While the ptx genes of B. parapertussis and B. bronchiseptica contain sequence variations compared to B. pertussis, both species retain functional ptl genes, including ptlE. When provided with a functional promoter, B. bronchiseptica demonstrates the capacity for both production and efficient secretion of pertussis toxin, indicating functional conservation of the secretion machinery including PtlE .

The methodological approach to investigate structural and functional differences includes:

  • Sequence Alignment and Phylogenetic Analysis: Multiple sequence alignment of PtlE homologs reveals conserved regions, particularly around the catalytic domain containing the critical D53 and E62 residues. Visualization tools such as WebLogo can identify conservation patterns in amino acid sequences.

  • Homology Modeling: Using known structures of related glycohydrolases as templates, predictive structural models of PtlE variants can be generated to identify potential structural differences, especially around the active site.

  • Heterologous Complementation Studies: The functional equivalence of PtlE homologs can be tested by expressing different species' variants in a B. pertussis PtlE knockout strain and assessing restoration of toxin secretion.

  • Recombinant Protein Production and Activity Comparison: Expression of the different PtlE homologs as recombinant proteins, followed by comparative enzymatic activity assays, can quantitatively assess functional conservation across species.

The toxin encoded by B. parapertussis appears more labile in culture supernatants compared to B. pertussis or engineered B. bronchiseptica, which may reflect subtle differences in the secretion process potentially relating to variations in PtlE structure or function .

What are the optimal conditions for expression and purification of recombinant PtlE protein?

Optimal expression and purification of recombinant PtlE requires careful consideration of expression systems, solubility factors, and purification strategies:

Expression System Optimization:

  • E. coli Expression: The recombinant PtlE homolog from B. bronchiseptica has been successfully expressed in E. coli with an N-terminal histidine tag. For optimal expression, consider:

    • E. coli strains specialized for membrane/periplasmic protein expression (e.g., C41(DE3), C43(DE3))

    • Induction at lower temperatures (16-20°C) to promote proper folding

    • Reduced IPTG concentrations (0.1-0.5 mM) for slower, more controlled expression

  • Native Expression: Expression in B. pertussis can also be achieved but typically yields lower protein amounts while potentially providing more authentic post-translational modifications or folding

Purification Protocol:

StepMethodologyBuffer CompositionCritical Parameters
Cell LysisSonication or pressure-based methods50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, protease inhibitorsKeep samples cold; gentle lysis for membrane proteins
IMAC PurificationNickel or cobalt affinity chromatographyBinding: Same as lysis buffer; Elution: Gradual increase to 250 mM imidazoleFlow rate 0.5-1 ml/min; monitor UV absorbance
Size ExclusionGel filtration chromatography20 mM Tris-HCl pH 7.5, 150 mM NaClSeparate monomeric protein from aggregates
StorageFlash freezing or lyophilizationTris/PBS-based buffer with 6% trehalose, pH 8.0Aliquot to avoid freeze-thaw cycles

Solubility Considerations: As PtlE is likely associated with membranes in its native context, solubility enhancement strategies may include:

  • Addition of mild detergents (0.05-0.1% n-dodecyl-β-D-maltoside)

  • Inclusion of glycerol (10-15%) in buffers

  • Expression as fusion proteins with solubility-enhancing tags (e.g., MBP, SUMO)

For reconstitution after lyophilization, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and glycerol (5-50% final concentration) can be added for long-term storage at -20°C/-80°C .

How can researchers assess the impact of PtlE mutations on T4SS assembly and function?

Investigating the consequences of PtlE mutations on T4SS assembly and function requires a multidisciplinary approach combining molecular biology, microscopy, and functional assays:

Genetic Engineering Approaches:

  • Site-Directed Mutagenesis: Beyond the known critical residues (D53 and E62), systematic alanine scanning of conserved residues across the protein can identify additional functionally important sites. The mutations should be introduced into both recombinant expression constructs and the chromosomal ptlE gene in B. pertussis using allelic exchange techniques .

  • Domain Swap Experiments: Creating chimeric proteins by exchanging domains between PtlE homologs from different Bordetella species can help identify species-specific functional regions.

Structural Assembly Assessment:

  • Blue Native PAGE: This technique can be used to analyze intact membrane protein complexes extracted with mild detergents, allowing evaluation of how PtlE mutations affect the formation of higher-order T4SS complexes.

  • Electron Microscopy: Transmission electron microscopy of negatively stained or cryo-prepared samples can directly visualize T4SS complex formation, similar to the approaches used for the Legionella pneumophila T4SS core complex. Comparing wild-type and mutant strains can reveal structural defects in complex assembly .

  • Fluorescence Microscopy: Tagging PtlE and other T4SS components with fluorescent proteins allows live-cell imaging of complex formation and localization. FRET-based approaches can further assess protein-protein interactions within the complex.

Functional Consequence Assays:

  • Toxin Secretion Quantification: The ultimate functional readout remains pertussis toxin secretion, which can be quantified by:

    • ELISA assays of culture supernatants

    • Western blotting of cellular versus supernatant fractions

    • Enzymatic activity assays of secreted toxin

  • Peptidoglycan Modification Analysis: The direct consequence of PtlE activity can be assessed by analyzing peptidoglycan structure using:

    • HPLC analysis of muropeptides

    • Mass spectrometry to detect modified peptidoglycan fragments

    • Fluorescent peptidoglycan labeling combined with microscopy

A comprehensive experimental matrix combining mutations at different protein regions with multiple structural and functional assessments will provide the most complete understanding of structure-function relationships in PtlE and its role in T4SS assembly .

What are the current knowledge gaps in PtlE research and promising future directions?

Despite significant advances in understanding PtlE's role as a peptidoglycanase in the T4SS of Bordetella species, several knowledge gaps persist that represent promising avenues for future research:

Structural Characterization: While the peptidoglycanase activity of PtlE has been established, a high-resolution three-dimensional structure remains elusive. X-ray crystallography or cryo-electron microscopy studies of purified PtlE would provide crucial insights into its catalytic mechanism and substrate recognition .

Temporal and Spatial Regulation: How PtlE activity is regulated during T4SS assembly remains poorly understood. Questions persist about whether its peptidoglycanase activity is constitutive or triggered by specific assembly events, and how its activity is spatially restricted to prevent widespread peptidoglycan degradation.

Interaction Network Mapping: While PtlE is known to be part of the T4SS complex, the precise interaction network with other Ptl proteins remains incompletely characterized. Systematic protein-protein interaction studies using techniques like hydrogen-deuterium exchange mass spectrometry could elucidate these relationships .

Substrate Specificity: The exact peptidoglycan bonds targeted by PtlE and whether its activity differs from other characterized peptidoglycanases require further investigation. Detailed biochemical studies with defined peptidoglycan fragments could address this gap.

Evolutionary Conservation: Comparative studies across diverse bacterial secretion systems could reveal whether peptidoglycanase activity is a conserved feature of T4SS assembly across species beyond Bordetella, potentially identifying it as a universal requirement for trans-envelope complex formation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.