Recombinant Bordetella bronchiseptica Type IV secretion system protein ptlG homolog (ptlG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag type, please specify it in your order; we will prioritize fulfilling such requests.
Synonyms
ptlG; BB4901; Type IV secretion system protein PtlG homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-374
Protein Length
full length protein
Species
Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)
Target Names
ptlG
Target Protein Sequence
MLNRPSSPDGGEAHAWPPDPEIPVFANAEHAHRRPLRWMFALVAVALSCLLATGIWRSRA APPHAATQTVAPAGQALPPGRIFTVHPREPEPAPLPDMPAAPDPILPQPRPAPPVPPPPI RAPYDYDEPAPRRDSAALKSGPAMMVATAARLGQTERAGMADDGVSADAATLIGRNVSRA TRSGDRDYRLLPGTFIDCILQTRIVTNVPGLTTCIVSRDVYSASGKRVLVPRGTTVVGEY RADLAQGSQRIYVAWSRLFMPSGLTIELASPAVDGTGAAGLPGVVDDKFAQRFGGALLLS VLGDATSYMLARATDARHGVNVNLTAAGTMNSLAASALNNTINIPPTLYKNHGDQIGILV ARPLDFSILRGTNE
Uniprot No.

Target Background

Database Links

KEGG: bbr:BB4901

STRING: 257310.BB4901

Protein Families
TrbI/VirB10 family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the Bordetella bronchiseptica Type IV secretion system protein ptlG homolog?

The ptlG protein is a critical component of the Type IV secretion system (T4SS) in Bordetella bronchiseptica. It functions as part of the pertussis toxin liberation (Ptl) system, which is responsible for the secretion of pertussis toxin (PT). The full-length protein consists of 374 amino acids and contains various functional domains necessary for its role in toxin secretion . The ptlG gene is part of the ptl operon that encodes multiple proteins (PtlA-PtlI) forming the secretion apparatus essential for toxin translocation across the bacterial membrane.

How does ptlG function within the Bordetella Type IV secretion system?

The ptlG protein serves as a structural component of the T4SS machinery in Bordetella species. Within this system, ptlG works in conjunction with other Ptl proteins to form a secretion complex that facilitates the export of pertussis toxin from the bacterial cell. While B. pertussis is known as the primary producer of pertussis toxin, research has demonstrated that B. bronchiseptica contains all essential ptl genes necessary for toxin secretion when a functional promoter is introduced upstream of the ptx-ptl region . This indicates that ptlG and other Ptl proteins in B. bronchiseptica form a functional secretion apparatus that can efficiently transport toxin molecules across the cell envelope.

How conserved is ptlG across different Bordetella species?

The ptlG homolog is found across classical Bordetella species, including B. pertussis, B. bronchiseptica, and B. parapertussis. Research indicates that while B. pertussis is the primary producer of pertussis toxin, both B. bronchiseptica and B. parapertussis contain genes homologous to the ptx-ptl region . Comparative genomic studies suggest that B. bronchiseptica contains all essential ptl genes, including ptlG, which enables efficient toxin secretion when properly activated. The conservation of ptlG across these species underscores its fundamental importance in the secretion machinery, though subtle sequence variations may exist that reflect adaptation to different hosts.

What are the optimal conditions for reconstitution and storage of recombinant ptlG protein?

For optimal handling of recombinant ptlG protein, researchers should follow these methodological guidelines:

  • Reconstitution protocol: The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Storage recommendations: Add 5-50% glycerol (final concentration) to the reconstituted protein and create working aliquots to avoid repeated freeze-thaw cycles .

  • Temperature conditions: Store working aliquots at 4°C for up to one week; for long-term storage, maintain at -20°C or -80°C .

  • Handling precautions: Briefly centrifuge the vial prior to opening to bring contents to the bottom. Avoid repeated freeze-thaw cycles as they may degrade protein quality and activity .

What expression systems have proven effective for producing functional recombinant ptlG?

The E. coli expression system has been successfully employed for the production of recombinant ptlG protein with an N-terminal His tag . This approach allows for efficient expression and subsequent purification using affinity chromatography. When expressing ptlG in heterologous systems, researchers should consider:

  • Codon optimization: Adjusting codons to match the preferred usage of the expression host.

  • Affinity tags: The use of His-tags facilitates purification while minimally affecting protein structure.

  • Expression conditions: Optimizing temperature, induction parameters, and growth media to maximize protein yield and solubility.

  • Protein folding: Monitoring proper folding to ensure functional activity of the recombinant protein.

What is the relationship between the ptl secretion system and pertussis toxin production?

The relationship between the Ptl secretion system and pertussis toxin involves a sophisticated regulatory mechanism:

  • While B. pertussis is the only bacterial species known to naturally produce pertussis toxin, both B. bronchiseptica and B. parapertussis contain homologous ptx genes encoding toxin subunits .

  • When a functional promoter is inserted upstream of the ptx-ptl region in B. bronchiseptica, biologically active pertussis toxin is produced and efficiently secreted, demonstrating that the ptl system (including ptlG) is functionally competent .

  • Despite amino acid changes in the sequences of the toxins produced by different Bordetella species, the toxins encoded by B. bronchiseptica and B. parapertussis remain biologically active .

This indicates that the ptl secretion system (including ptlG) plays a critical role in the export of pertussis toxin and that this machinery is conserved across Bordetella species, though naturally regulated differently.

What techniques are most effective for studying ptlG function in vitro?

Several methodological approaches can be employed to investigate ptlG function:

  • Protein-protein interaction studies: Techniques such as pull-down assays, yeast two-hybrid systems, or co-immunoprecipitation can identify binding partners of ptlG within the secretion apparatus.

  • Site-directed mutagenesis: Creating specific mutations in ptlG can help identify critical residues for protein function.

  • Recombinant expression systems: Using heterologous expression systems with reporter molecules to assess secretion efficiency.

  • Structural biology approaches: Techniques such as X-ray crystallography or cryo-electron microscopy could provide insights into ptlG's three-dimensional structure and functional domains.

How can researchers verify the functionality of recombinant ptlG protein?

Verifying the functionality of recombinant ptlG requires multiple complementary approaches:

  • Complementation studies: Introducing recombinant ptlG into ptlG-deficient Bordetella strains to test restoration of toxin secretion.

  • Secretion assays: Measuring pertussis toxin secretion efficiency in systems expressing wild-type versus mutant ptlG.

  • Protein interaction verification: Confirming that recombinant ptlG properly interacts with other Ptl proteins as expected.

  • Structural integrity assessment: Using circular dichroism or other biophysical techniques to ensure proper protein folding.

How does the Type IV secretion system containing ptlG differ from the Type III secretion system in Bordetella?

The Type IV and Type III secretion systems in Bordetella represent distinct machineries with different structures and functions:

FeatureType IV Secretion System (ptlG)Type III Secretion System
Primary functionSecretion of pertussis toxinTranslocation of effector proteins directly into host cells
Evolutionary originRelated to conjugation machineryEvolved from flagellar apparatus
Key componentsPtl proteins (PtlA-PtlI)Bsc and Btr proteins
StructureForms a channel spanning inner and outer membranesForms a needle-like injectosome structure
RegulationRequires insertion of functional promoter in B. bronchiseptica for activityRegulated by BvgAS system, ECF sigma factor BtrS, and partner-switcher proteins

While the Type III secretion system in Bordetella is involved in the direct injection of effector proteins like BteA into host cells , the Type IV system containing ptlG is specialized for the secretion of pertussis toxin into the extracellular environment .

What are the functional analogs of ptlG in other bacterial pathogens?

Functional analogs of ptlG exist in various bacterial species with Type IV secretion systems:

  • Several bacterial pathogens utilize T4SS for virulence, including Agrobacterium tumefaciens (VirB system), Helicobacter pylori (Cag system), and Legionella pneumophila (Dot/Icm system).

  • These systems share structural and functional similarities with the Ptl system of Bordetella, though they may secrete different effector molecules.

  • Comparative analysis of ptlG homologs across species could provide insights into conserved mechanisms of T4SS assembly and function.

What are the current knowledge gaps regarding ptlG function in Bordetella virulence?

Several important questions remain unanswered regarding ptlG's role in Bordetella pathogenesis:

  • The precise molecular mechanism by which ptlG contributes to T4SS assembly and function requires further elucidation.

  • The regulatory controls governing ptlG expression in different Bordetella species remain incompletely understood.

  • The potential role of ptlG in host-pathogen interactions beyond toxin secretion warrants investigation.

  • More research is needed to understand how ptlG variants might influence virulence differences observed between Bordetella species.

How might recombinant ptlG be utilized in the development of novel therapeutics or vaccines?

Recombinant ptlG protein holds potential for various therapeutic and vaccine applications:

  • Structure-based drug design: Detailed structural information about ptlG could facilitate the development of small-molecule inhibitors targeting the T4SS to prevent toxin secretion.

  • Vaccine development: Recombinant ptlG might serve as a potential vaccine antigen or component of acellular pertussis vaccines.

  • Diagnostic applications: Anti-ptlG antibodies could be developed for diagnostic purposes to detect Bordetella infections.

  • Research tools: Recombinant ptlG can serve as a valuable tool for studying T4SS assembly and function in various experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.