Recombinant Bordetella bronchiseptica Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format during order placement, and we will endeavor to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is preferred, please communicate with us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
While we aim to provide a tag type that meets your specific needs, please inform us if you have a preference for a particular tag type. We will prioritize the development of the specified tag accordingly.
Synonyms
uppP; bacA; upk; BB1731; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)
Target Names
uppP
Target Protein Sequence
MTDSTLHLLKAFFLGIVEGLTEFIPVSSTGHLIVIGDWINFASSSGKVFEVVIQFGSILA VMWIFRARLWQLIRGTLTGVRQEVNFTRNLLLAFLPAAVIGAIFIKSIKQVFYHPGVVAV TLVVGGFIMLWVERRAPHTPGDAPGAADDTASDERATAHTLEQISAKQALGVGVAQCVAM IPGVSRSGATIIGGMIAGIQRKTATEFSFFLAMPTMLGAAVYDLYRNIGLLSQHDMSAIA VGFVAAFLSALVVVRAVLRFVANHTYRVFAWYRIALGLVVAAWIYAK
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: bbr:BB1731

STRING: 257310.BB1731

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Undecaprenyl-diphosphatase (uppP) in bacterial cell wall synthesis?

Undecaprenyl-diphosphatase (uppP) functions as a critical UPP phosphatase in the lipid II cycle of bacterial cell wall synthesis. This enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), which is essential for peptidoglycan precursor transport across the cytoplasmic membrane. In organisms like Bacillus subtilis, uppP (previously known as YubB) is homologous to BacA from E. coli, where it accounts for approximately 75% of UPP phosphatase activity . The enzyme is encoded as the second gene in the yubA-uppP operon, and its expression is not induced by antibiotics like bacitracin in B. subtilis . The recycling of UP by UPP phosphatases is crucial for maintaining the lipid II cycle and ensuring proper cell wall synthesis and cellular integrity.

How does uppP in Bordetella bronchiseptica compare to homologous proteins in other bacterial species?

While specific comparative data for B. bronchiseptica uppP is limited in the provided research, evidence from studies on related bacteria suggests functional conservation with notable species-specific adaptations. In B. subtilis, uppP forms an essential pair with BcrC (another UPP phosphatase), creating a synthetic lethal relationship where at least one must be present for cell viability . The uppP protein shows homology to BacA in E. coli, suggesting conserved catalytic mechanisms across different bacterial species . B. bronchiseptica, as a respiratory pathogen with a complex cell envelope structure, likely depends on uppP for similar cell wall synthesis functions, though potentially with adaptations related to its pathogenic lifestyle and host-pathogen interactions.

What phenotypic effects result from uppP deletion or depletion in bacterial models?

Deletion or depletion of uppP produces several significant phenotypic effects:

  • Morphological defects: In B. subtilis, severe morphological changes including bulging cells occur during exponential growth when UPP phosphatases are depleted, resembling defects observed with compromised peptidoglycan or wall teichoic acid synthesis .

  • Sporulation deficiency: UppP is indispensable for efficient sporulation. B. subtilis strains lacking uppP show dramatically reduced sporulation rates (<7% compared to >30% in wild type) and produce phase-gray rather than phase-bright spores, indicating alterations in spore cortex formation .

  • Synthetic lethality: Complete deletion of both uppP and bcrC is not viable, demonstrating that at least one UPP phosphatase must be present for bacterial survival .

  • Antibiotic sensitivity: While deletion of uppP alone may not significantly affect bacitracin sensitivity, combined limitations in UPP phosphatase activity result in increased susceptibility to cell wall-targeting antibiotics .

The effects highlight uppP's crucial role in maintaining cell envelope integrity and proper cellular development.

What are the optimal conditions for recombinant expression of B. bronchiseptica uppP?

For optimal recombinant expression of B. bronchiseptica uppP, researchers should consider:

Expression System Selection:

  • E. coli BL21(DE3) or similar strains often provide high yields for membrane-associated proteins like uppP

  • Expression vectors containing T7 promoters (pET series) with appropriate fusion tags (His6, MBP, or SUMO) enhance solubility

Culture Conditions:

  • Initial growth at 37°C to OD600 of 0.6-0.8

  • Temperature reduction to 16-18°C before induction minimizes inclusion body formation

  • IPTG concentration of 0.1-0.5 mM for induction

  • Extended expression period (16-20 hours) at reduced temperature

Buffer Optimization:

  • Inclusion of mild detergents (0.5-1% n-dodecyl β-D-maltoside or CHAPS) aids extraction

  • Addition of 10-15% glycerol stabilizes membrane protein structure

  • pH maintenance between 7.5-8.0 with phosphate or Tris-based buffers

While B. bronchiseptica-specific protocols are not detailed in the provided research, these approaches have proven effective for recombinant UPP phosphatases from other bacterial species and can be adapted based on experimental outcomes .

What purification strategies yield the highest activity for recombinant uppP preparations?

For maximum enzymatic activity of purified recombinant uppP, a multi-step purification approach is recommended:

Affinity Chromatography (Primary Step):

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged uppP

  • Gradual imidazole gradient (20-250 mM) minimizes contaminant binding while maximizing target protein recovery

  • Inclusion of low detergent concentrations (0.05-0.1%) throughout purification maintains protein solubility

Secondary Purification:

  • Size exclusion chromatography separates active oligomeric forms from aggregates

  • Ion exchange chromatography (particularly anion exchange) removes remaining contaminants

  • Consider using Superdex 200 columns for optimal separation

Activity Preservation Considerations:

  • Addition of stabilizing additives (5-10% glycerol, 1 mM DTT, 0.5 mM EDTA)

  • Storage buffer optimization with 50 mM HEPES/Tris pH 7.5, 150 mM NaCl

  • Flash freezing in liquid nitrogen with storage at -80°C in small aliquots

Quality Control Metrics:

  • Enzymatic activity assessment using synthetic substrates like diphosphoryl-undecaprenol

  • SEC-MALS analysis to confirm appropriate oligomeric state

  • Thermal shift assays to evaluate stability under various buffer conditions

These techniques have proven valuable for membrane-associated phosphatases and should yield highly active uppP preparations suitable for structural and functional studies .

How can researchers overcome solubility challenges associated with membrane-associated proteins like uppP?

Overcoming solubility challenges for membrane-associated proteins like uppP requires specialized strategies:

Fusion Tag Selection:

  • SUMO-tag systems significantly enhance solubility while maintaining native conformation

  • MBP (maltose-binding protein) fusions show superior solubilizing properties compared to GST or His tags alone

  • Combining a small His-tag with larger solubility enhancers allows two-step purification

Expression Modifications:

  • Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE systems)

  • Utilizing specialized E. coli strains designed for membrane protein expression (C41, C43, Lemo21)

  • Auto-induction media formulations providing gradual induction rather than IPTG shock

Extraction Optimization:

  • Screening detergent panels (ranging from harsh [SDS] to mild [DDM, LDAO, CHAPS])

  • Employing detergent-lipid mixed micelles to mimic native membrane environment

  • Utilizing styrene maleic acid copolymer (SMA) for native nanodiscs formation

Refolding Strategies (if inclusion bodies form):

  • On-column refolding during purification with decreasing denaturant gradients

  • Dilution-based refolding with pulsatile addition to prevent aggregation

  • Inclusion of chemical chaperones (arginine, glycerol, sucrose) in refolding buffers

A systematic approach combining these strategies can dramatically improve yields of functional recombinant uppP protein for downstream applications .

What assays accurately measure undecaprenyl-diphosphatase activity in recombinant uppP preparations?

Several complementary approaches can reliably measure undecaprenyl-diphosphatase activity:

Direct Enzymatic Activity Assays:

  • Colorimetric Phosphate Release Detection

    • Malachite green-based detection of free phosphate

    • Sensitivity: 0.1-10 nmol phosphate

    • Advantage: Compatible with high-throughput screening formats

    • Limitation: Possible interference from buffer components

  • Radiometric Assays

    • Using [γ-32P]-labeled substrate

    • Extremely sensitive (picomole range)

    • Requires separation of products by TLC and quantification by phosphorimaging

    • Provides detailed kinetic parameters (Km, Vmax, kcat)

  • Coupled Enzyme Assays

    • Linking phosphate release to NADH oxidation via auxiliary enzymes

    • Allows real-time monitoring using spectrophotometric methods

    • Useful for inhibitor screening and kinetic studies

Analysis Parameters for UppP Activity Characterization:

ParameterTypical RangeMeasurement Method
Km for UPP5-50 μMSubstrate concentration series
kcat1-100 s⁻¹Initial velocity at saturating substrate
pH Optimum6.5-8.0Activity profiling across pH range
Divalent Ion Requirement1-10 mM Mg²⁺/Mn²⁺Metal chelation and reconstitution
Temperature Optimum30-42°CActivity profiling across temperature range

In Vivo Complementation Assays:

  • Complementation of synthetic lethal uppP/bcrC double mutants

  • Bacitracin sensitivity testing (MIC determination)

  • Morphological rescue assessment via microscopy

These methods provide comprehensive characterization of recombinant uppP enzyme activity and functionality.

How do point mutations in critical residues affect uppP catalytic activity and substrate specificity?

Point mutations in critical residues of uppP can significantly impact catalytic activity and substrate specificity, offering insights into structure-function relationships:

Residue Categories and Their Functional Impact:

  • Catalytic Site Residues

    • Mutations in presumed nucleophilic residues (conserved aspartate or glutamate) typically abolish activity

    • Histidine substitutions in the proposed catalytic triad eliminate phosphatase function

    • Conservative substitutions (Asp→Glu) may retain partial activity (~10-30% of wild-type)

  • Substrate-Binding Pocket Residues

    • Hydrophobic to polar substitutions in the isoprenoid-binding region alter substrate preference

    • Mutations expanding the binding pocket may accommodate structurally different substrates

    • Changes to positively charged residues interacting with phosphate groups affect substrate affinity

  • Membrane-Interface Residues

    • Alterations to amphipathic helices affect membrane association and substrate accessibility

    • Hydrophobicity changes impact proper positioning relative to the lipid bilayer

    • Tryptophan or tyrosine substitutions at membrane interfaces can enhance or disrupt activity

Functional Consequences of Various Mutations:

Based on studies of related UPP phosphatases, predictable effects include:

Mutation TypeEffect on Enzyme KineticsStructural ImpactPhenotypic Outcome
Active site nucleophileDecreased kcat (10-1000 fold)Minimal structural changeLoss of complementation ability
Metal coordination siteAltered metal preferenceLocal conformation changeChanged inhibitor sensitivity
Membrane interfaceReduced membrane associationAltered orientation in membraneDecreased in vivo activity
Substrate bindingChanged substrate specificityMinor pocket reshapingModified substrate range

Systematic mutagenesis studies would help identify residues critical for B. bronchiseptica uppP function and potentially reveal species-specific adaptations relevant to pathogenesis .

What high-throughput methods exist for screening inhibitors of Bordetella bronchiseptica uppP?

High-throughput screening of B. bronchiseptica uppP inhibitors can be approached through several complementary methods:

In Vitro Enzymatic Assays:

  • Microplate-Based Phosphate Detection

    • 384-well format using malachite green or similar phosphate-detection reagents

    • Z-factor optimization through buffer and detergent screening

    • Automation-compatible with liquid handling systems

    • Data normalization using positive (known inhibitors) and negative controls

  • Fluorescence-Based Substrate Analogs

    • Development of fluorogenic UPP analogs

    • FRET-based detection systems measuring conformational changes upon substrate binding

    • Fluorescence polarization assays for direct binding assessment

Cell-Based Screening Systems:

  • Reporter-Based Assays

    • Engineered B. subtilis strains with uppP/bcrC mutations complemented with B. bronchiseptica uppP

    • Reporter constructs (luciferase) linked to cell envelope stress response promoters (P₍σᴹ₎)

    • Increased reporter activity indicates uppP inhibition

  • Growth Inhibition in Sensitized Strains

    • Strains with reduced UPP phosphatase activity show enhanced sensitivity

    • Sub-lethal bacitracin concentrations potentiate effects of uppP inhibitors

    • Allows identification of compounds with cellular permeability

Computational Pre-Screening:

  • Homology modeling of B. bronchiseptica uppP based on related structures

  • Virtual screening of compound libraries targeting the active site

  • Pharmacophore modeling based on known phosphatase inhibitors

  • Molecular dynamics simulations to identify transient binding pockets

Confirmation and Validation Pipeline:

  • IC₅₀ determination for promising hits (typical range: 0.1-50 μM)

  • Selectivity assessment against human phosphatases

  • Mode of inhibition analysis (competitive, uncompetitive, mixed)

  • Cellular toxicity evaluation in mammalian cell lines

These approaches provide complementary data streams for identifying potential uppP inhibitors that could serve as research tools or starting points for antimicrobial development .

What structural information is available about uppP and how can researchers obtain crystallographic data?

Current structural information about Bordetella bronchiseptica uppP specifically is limited, but researchers can leverage approaches used for homologous proteins:

Current Structural Knowledge:

  • UppP belongs to the PAP2 superfamily of phosphatases based on sequence homology

  • Homologous structures (like BacA from E. coli) suggest a multi-transmembrane domain architecture

  • Predicted topology includes 6-8 membrane-spanning segments with a periplasmic catalytic domain

Crystallization Strategies for uppP:

  • Membrane Protein Crystallization Approaches:

    • Lipidic cubic phase (LCP) crystallization has shown success with related membrane phosphatases

    • Detergent screening (typically 20+ detergents) to identify optimal solubilization conditions

    • Addition of lipids (phosphatidylcholine, cardiolipin) to stabilize native conformation

    • Use of antibody fragments (Fab, nanobodies) to increase polar surface area

  • Construct Optimization:

    • N- and C-terminal truncation series to remove disordered regions

    • Thermostability screening using differential scanning fluorimetry

    • Surface entropy reduction by mutating flexible, charged residues

    • Fusion partners (T4 lysozyme, BRIL) inserted into loops to aid crystallization

Alternative Structural Biology Methods:

  • Cryo-Electron Microscopy:

    • Single-particle analysis of purified uppP in nanodiscs or amphipols

    • Potential for 3-4Å resolution without crystallization

    • Advantages for visualizing different conformational states

  • NMR Spectroscopy:

    • Selective isotopic labeling for targeted structural analysis

    • Solid-state NMR approaches for membrane-embedded regions

    • Solution NMR for soluble domains or fragments

Data Collection and Processing Considerations:

  • Synchrotron radiation sources typically required due to small crystal size

  • Serial crystallography approaches for microcrystals

  • Phase determination using selenomethionine substitution or heavy atom soaking

  • Molecular replacement using related structures as search models

By applying these approaches, researchers can work toward obtaining high-resolution structural data for B. bronchiseptica uppP that would significantly advance understanding of its mechanism and species-specific features .

How does the membrane topology of uppP influence its function and substrate accessibility?

The membrane topology of uppP plays a crucial role in determining its function, substrate accessibility, and regulatory mechanisms:

Predicted Topological Features:

  • UppP likely contains 7-8 transmembrane helices based on homology to characterized UPP phosphatases

  • The active site is positioned to access UPP at the membrane-periplasm interface

  • Hydrophobic substrate-binding pocket accommodates the undecaprenyl moiety

  • Positively charged residues interact with the pyrophosphate head group

Functional Implications of Membrane Positioning:

  • Substrate Capture Mechanism

    • Lateral diffusion of UPP within the membrane allows enzyme access

    • The orientation of catalytic residues enables attack on the pyrophosphate bond

    • The hydrophobic channel likely guides the lipid tail during substrate binding

  • Integration with Cell Wall Synthesis Machinery

    • Spatial proximity to other lipid II cycle components enables efficient substrate channeling

    • Co-localization with peptidoglycan synthesis complexes may occur at specific cellular locations

    • During sporulation, specialized localization patterns may explain uppP's critical role in this process

  • Regulatory Access

    • Conformational changes may regulate accessibility of the active site

    • Potential interplay with membrane composition (phospholipid content, fluidity)

    • Possible protein-protein interactions affecting activity through topological constraints

Experimental Approaches to Study Topology-Function Relationships:

ApproachInformation ProvidedTechnical Considerations
Cysteine scanning mutagenesisAccessibility mapping of residuesRequires cysteine-free background
GFP-fusion analysisTerminal orientation determinationMay affect protein folding
Protease protection assaysLoop and domain localizationLimited by protease specificity
FRET-based sensorsDynamic conformational changesRequires fluorophore incorporation
Crosslinking studiesProtein-protein interaction mappingChemistry must be compatible with membrane environment

Understanding how uppP's membrane topology influences its function provides insights into its essential role in bacterial cell wall synthesis and potentially reveals species-specific adaptations in B. bronchiseptica that could be exploited for targeted inhibition .

What computational approaches can predict substrate binding modes and catalytic mechanisms for uppP?

Several computational approaches can effectively predict substrate binding modes and catalytic mechanisms for uppP:

Homology Modeling and Structural Prediction:

  • Template Selection and Alignment

    • Identification of homologous structures with solved crystal structures (e.g., E. coli BacA)

    • Multiple sequence alignment of UPP phosphatases across bacterial species

    • Secondary structure prediction to guide alignment in transmembrane regions

    • Threading approaches for regions with low sequence identity

  • Model Building and Refinement

    • Rosetta membrane protein modeling suite for transmembrane region optimization

    • MODELLER for initial backbone generation

    • Molecular dynamics-based refinement in explicit membrane environments

    • Model quality assessment using ProSA, QMEAN, and Molprobity

Substrate Docking and Binding Site Analysis:

  • Preparation of UPP Substrate

    • Parameterization of the undecaprenyl pyrophosphate for various force fields

    • Generation of multiple conformers to account for lipid tail flexibility

    • QM calculations for accurate partial charge assignment

  • Docking Methodologies

    • Induced-fit docking to account for protein flexibility

    • GOLD or AutoDock Vina with customized scoring functions for membrane proteins

    • Ensemble docking using multiple protein conformations

    • Constraints based on mutational data or conserved residue positioning

Catalytic Mechanism Elucidation:

  • Quantum Mechanics/Molecular Mechanics (QM/MM)

    • Hybrid calculations with QM treatment of catalytic residues and substrate

    • Reaction coordinate mapping for phosphate hydrolysis

    • Transition state identification and energy barrier calculation

    • Proton transfer pathway analysis

  • Molecular Dynamics Simulations

    • Long-timescale (μs) simulations in explicit lipid bilayers

    • Free energy calculations using umbrella sampling or metadynamics

    • Water wire identification for proton shuttling

    • Conformational change analysis during catalytic cycle

Integration with Experimental Data:

  • Incorporation of distance constraints from crosslinking experiments

  • Validation using site-directed mutagenesis results

  • Refinement based on hydrogen-deuterium exchange mass spectrometry data

  • Iterative model improvement through experimental feedback

These computational approaches, when integrated with experimental validation, provide detailed atomic-level insights into how uppP recognizes its substrate and catalyzes the critical dephosphorylation reaction essential for bacterial cell wall synthesis .

How can recombinant uppP be utilized to develop novel antimicrobial strategies against Bordetella bronchiseptica?

Recombinant uppP offers several promising avenues for antimicrobial development against B. bronchiseptica:

Target-Based Inhibitor Development:

  • Structure-Based Drug Design

    • High-throughput virtual screening against uppP structural models

    • Fragment-based approaches to identify initial binding scaffolds

    • Structure-activity relationship development for identified hits

    • Pharmacophore modeling based on substrate recognition elements

  • Allosteric Inhibition Strategies

    • Identification of non-active site regulatory pockets

    • Design of molecules that lock uppP in inactive conformations

    • Investigation of protein-protein interaction interfaces as targets

Combination Therapy Approaches:

  • Synergistic Drug Pairs

    • UppP inhibitors combined with sub-MIC levels of bacitracin

    • Targeting multiple steps in the lipid II cycle simultaneously

    • Development of dual-action molecules affecting multiple targets

  • Sensitization Strategies

    • Compounds that upregulate efflux pump inhibitors

    • Permeabilizers that enhance uptake of uppP inhibitors

    • Modulators of cell envelope stress responses

Vaccine and Immunotherapy Development:

  • Recombinant UppP as Vaccine Component

    • Purified uppP or peptide epitopes as immunogens

    • Evaluation in combination with other protective antigens (PPP, PL)

    • Analysis of protective indices in animal challenge models

  • Antibody-Based Approaches

    • Development of neutralizing antibodies against extracellular loops

    • Generation of bifunctional antibodies linking uppP recognition with immune effectors

    • Antibody-antibiotic conjugates for targeted delivery

Efficacy Assessment Metrics:

ApproachEvaluation ParametersSuccess Criteria
Direct inhibitorsIC₅₀, MIC, kill kineticsActivity <10 μM, selective toxicity >100×
Combination therapyFICI, time-kill synergyFICI <0.5, >2 log₁₀ enhanced killing
ImmunizationAntibody titers, challenge protection>50% protection in animal models
Resistance developmentSerial passage frequencyResistance frequency <10⁻⁸

These approaches leverage the essential nature of uppP in bacterial cell wall synthesis to develop targeted antimicrobial strategies with potential for addressing B. bronchiseptica infections resistant to conventional treatments .

What role does uppP play in Bordetella bronchiseptica virulence and host-pathogen interactions?

While direct evidence from the provided research about B. bronchiseptica uppP's role in virulence is limited, several probable mechanisms can be inferred based on the enzyme's fundamental functions:

Cell Envelope Integrity and Virulence:

  • Stress Response Modulation

    • UppP depletion triggers cell envelope stress responses similar to antibiotic exposure

    • These stress responses often upregulate virulence factors expression

    • Proper UppP function maintains envelope homeostasis during host infection

  • Morphological Adaptations

    • UppP's role in maintaining cell shape impacts pathogen-host interactions

    • Altered morphology affects tissue adhesion and colonization properties

    • Cell wall integrity influences resistance to host defense peptides

Host Immune Response Interactions:

  • Pattern Recognition Evasion

    • Cell wall composition modulated by UppP activity affects PAMP recognition

    • Peptidoglycan fragments released during infection serve as immune activators

    • UppP-dependent cell wall modifications may help evade host detection

  • Biofilm Formation Capability

    • Cell envelope properties influence biofilm development

    • Chronic respiratory infections often involve biofilm communities

    • UppP's contribution to envelope homeostasis affects community behavior

Temporal Regulation During Infection:

  • Adaptation to Microenvironments

    • Expression changes in uppP during different infection stages

    • Potential phosphatase activity modulation in response to host conditions

    • Role in bacterial persistence during chronic infection states

  • Stress Adaptation Mechanisms

    • UppP may play a role in adaptation to oxidative stress in host environments

    • Contribution to antibiotic tolerance during therapy

    • Potential involvement in dormancy mechanisms

Experimental Approaches to Investigate UppP-Virulence Connections:

ApproachApplicationExpected Insights
Conditional depletionTemporal control of uppP expressionEffects on colonization and persistence
TranscriptomicsGene expression analysis under host-mimicking conditionsRegulatory networks involving uppP
Animal infection modelsComparison of wild-type vs. uppP-modified strainsIn vivo virulence assessment
Host-pathogen interactomicsProtein-protein interaction mappingIdentification of host targets
Immune response profilingCytokine/chemokine analysisHost recognition patterns

Understanding the interplay between uppP function and virulence could reveal new therapeutic opportunities targeting this essential enzyme to attenuate B. bronchiseptica pathogenicity while minimizing resistance development .

How can researchers design conditional expression systems to study the essential nature of uppP in B. bronchiseptica?

Designing effective conditional expression systems for studying essential genes like uppP in B. bronchiseptica requires sophisticated genetic tools and careful experimental design:

Inducible Promoter Systems:

  • Xylose-Inducible Expression

    • Adaptation of the B. subtilis PxylA promoter system for B. bronchiseptica

    • Titratable expression through varying xylose concentrations (0.1-2%)

    • Demonstrated efficacy for studying essential UPP phosphatases

    • Low background expression in glucose-containing media

  • Tetracycline-Responsive Systems

    • Implementation of Tet-ON/OFF regulatory elements

    • Anhydrotetracycline (aTc) as non-antibiotic inducer

    • Dose-dependent control with >100-fold induction range

    • Compatible with in vivo infection models

Destabilization Domain Approaches:

  • Protein Degradation Control

    • Fusion of uppP with destabilization domains (DD, e.g., DHFR-derived)

    • Stabilization using trimethoprim or similar small molecules

    • Rapid protein level control through stabilizer addition/removal

    • Maintains native promoter regulation while controlling protein levels

CRISPR Interference Systems:

  • Transcriptional Repression

    • Implementation of catalytically inactive Cas9 (dCas9)

    • Design of guide RNAs targeting uppP promoter or coding sequence

    • Titratable repression through inducible guide RNA expression

    • Simultaneous targeting of multiple genes if needed

Experimental Design Considerations:

ApproachAdvantagesLimitationsOptimization Strategies
Xylose-inducibleWell-characterized, titratablePotential metabolic effectsPre-adaptation to xylose, minimal media
Tet-regulatedTight control, in vivo compatibilityLeaky expressionCodon optimization, dual regulators
Destabilization domainRapid protein-level controlFusion may affect functionMultiple fusion positions, linker optimization
CRISPRiNo protein modification, multiplexableGuide RNA design criticalPAM site selection, guide RNA libraries

Phenotypic Analysis Framework:

  • Depletion Time-Course Studies

    • Monitoring morphological changes (as seen in B. subtilis)

    • Cell viability assessment using multiple methodologies

    • Transcriptomic and proteomic profiling during depletion

    • Cell wall composition analysis using biochemical/microscopy approaches

  • In Vivo Relevance

    • Conditional expression systems compatible with animal infection models

    • Tissue-specific or temporal control during infection course

    • Correlation of uppP expression levels with colonization/persistence

  • Synthetic Lethality Analysis

    • Identification of B. bronchiseptica homologs of bcrC

    • Systematic combinatorial depletion studies

    • Suppressor mutation screening to identify compensatory pathways

These approaches provide powerful tools for studying the essential functions of uppP in B. bronchiseptica, offering insights into its role in bacterial physiology and pathogenesis that could inform therapeutic development .

Can uppP-focused research contribute to vaccine development for Bordetella bronchiseptica infections?

UppP-focused research offers several promising avenues for B. bronchiseptica vaccine development:

Recombinant UppP as Vaccine Component:

  • Antigen Formulation Strategies

    • Purified recombinant uppP in adjuvant formulations

    • Extracellular loop peptides as subunit vaccine components

    • Combination with other protective B. bronchiseptica antigens like PPP and PL

    • Incorporation into outer membrane vesicle (OMV) vaccines

  • Immune Response Characterization

    • Analysis of antibody subtype profiles (IgG1/IgG2a ratios)

    • Assessment of cell-mediated immunity activation

    • Mucosal immunity induction evaluation

    • Duration of protective immunity determination

Protection Assessment Data:
Based on similar approaches with other B. bronchiseptica recombinant proteins, potential protection metrics include:

Antigen ApproachAntibody Titer (ELISA)Protection RatioImmune Response Type
UppP recombinant protein1:5,000 - 1:20,00040-60%Mixed Th1/Th2
UppP + adjuvant1:10,000 - 1:50,00050-70%Enhanced Th1
Multi-antigen (UppP+PPP+PL)1:20,000 - 1:100,00070-90%Balanced Th1/Th2

Note: These figures represent potential outcomes based on similar recombinant protein vaccines; actual values would require experimental determination

Delivery System Innovation:

  • Live Attenuated Vector Vaccines

    • Attenuated Bordetella strains expressing modified uppP epitopes

    • Recombinant probiotics expressing uppP immunogenic fragments

    • Self-adjuvanting particle systems incorporating uppP

  • Nucleic Acid Vaccine Approaches

    • DNA vaccines encoding optimized uppP sequences

    • mRNA formulations for enhanced antigen expression

    • Prime-boost strategies combining protein and genetic immunization

Challenge Model Development:

  • Standardized animal models mimicking natural infection routes

  • Quantitative assessment of bacterial clearance rates

  • Evaluation of protection against heterologous strains

  • Long-term protection studies in relevant animal hosts

The development of vaccines targeting uppP would benefit from the enzyme's essential nature and conservation across Bordetella species. While uppP alone might not provide complete protection, its inclusion in multivalent formulations alongside other protective antigens like PPP and PL could significantly enhance vaccine efficacy against B. bronchiseptica infections .

What is the relationship between uppP function and antibiotic resistance in Bordetella species?

The relationship between uppP function and antibiotic resistance in Bordetella species involves several interconnected mechanisms:

Direct Resistance Mechanisms:

  • Cell Wall Antibiotic Susceptibility

    • UppP overexpression may increase resistance to cell wall-targeting antibiotics

    • Altered UppP activity affects undecaprenyl phosphate recycling, influencing peptidoglycan synthesis rates

    • Similar to observations in other bacteria, uppP may compete with antibiotics like bacitracin for the UPP substrate

  • Membrane Permeability Effects

    • UppP's role in cell envelope biogenesis influences membrane composition

    • Changes in membrane properties affect uptake of various antibiotics

    • Altered lipid composition may modify proton motive force, affecting efflux pump efficiency

Regulatory Connections:

  • Cell Envelope Stress Response Modulation

    • UppP depletion triggers envelope stress responses as observed in B. subtilis

    • These stress responses often upregulate resistance determinants

    • ECF sigma factors activated by cell envelope perturbations regulate resistance genes

  • Adaptation and Persistence Mechanisms

    • UppP function may contribute to adaptations allowing persistence during antibiotic therapy

    • Potential role in biofilm formation, where antibiotic resistance is enhanced

    • Possible involvement in dormancy or slow-growth phenotypes associated with tolerance

Experimental Findings from Related Species:
While specific data for Bordetella is limited, evidence from other bacteria shows:

OrganismUppP-Related ObservationAntibiotic Resistance Phenotype
B. subtilisBcrC (UppP homolog) deletionIncreased bacitracin sensitivity (MIC reduction from >256 to ~120 μg/ml)
B. subtilisUppP/BcrC depletionHypersensitivity to multiple cell wall antibiotics
E. coliBacA (UppP homolog) overexpressionIncreased bacitracin resistance
Various bacteriaUppP mutationsAltered susceptibility to glycopeptides and β-lactams

Clinical Implications:

  • Diagnostic Applications

    • UppP activity levels as potential markers for resistance phenotypes

    • Genetic polymorphisms in uppP possibly correlating with treatment outcomes

    • Expression profiling during infection to predict antibiotic response

  • Therapeutic Strategies

    • UppP inhibitors as antibiotic adjuvants to enhance effectiveness

    • Combination therapies targeting both uppP and other cell wall synthesis steps

    • Counter-resistance approaches based on uppP expression patterns

Understanding the relationship between uppP function and antibiotic resistance could reveal new approaches for combating resistant Bordetella infections and guide antibiotic stewardship decisions .

How might comparative analysis of uppP across Bordetella species inform respiratory pathogen treatment strategies?

Comparative analysis of uppP across Bordetella species offers valuable insights for developing targeted respiratory pathogen treatment strategies:

Evolutionary Conservation and Divergence:

  • Sequence Analysis Across Bordetella Species

    • Identification of highly conserved catalytic residues as universal targets

    • Species-specific variations in substrate-binding regions

    • Evolutionary pressure analysis revealing functional constraints

    • Correlation between sequence variations and host adaptation

  • Structural Comparison

    • Species-specific differences in active site architecture

    • Unique binding pocket features that could be exploited for selective targeting

    • Conservation mapping onto structural models to identify druggable differences

Functional Divergence Assessment:

Bordetella SpeciesHost RangeUppP Distinctive FeaturesPotential Clinical Implications
B. bronchisepticaBroad (mammals)Potentially broader substrate toleranceMulti-host transmission, veterinary relevance
B. pertussisHumans onlyPossible human-specific adaptationsWhooping cough treatment, vaccine development
B. parapertussisHumans/sheepIntermediate featuresZoonotic infection potential
B. aviumBirdsDistant homology, unique featuresVeterinary applications, poultry industry

Pan-Bordetella vs. Species-Specific Approaches:

  • Broad-Spectrum Intervention Strategies

    • Targeting highly conserved catalytic sites across all Bordetella species

    • Development of pan-Bordetella vaccines using conserved uppP epitopes

    • Universal diagnostic tools based on conserved uppP sequences

  • Species-Tailored Treatment Approaches

    • Exploitation of unique structural features for selective inhibition

    • Host-specific vaccine formulations incorporating species-variant epitopes

    • Precision diagnostics differentiating between Bordetella species

Translational Applications:

  • Human Medicine

    • Insights for B. pertussis (whooping cough) treatment options

    • Management strategies for immunocompromised patients with B. bronchiseptica infections

    • Combined targeting approaches for mixed Bordetella infections

  • Veterinary Medicine

    • Species-optimized treatments for kennel cough in dogs

    • Management of atrophic rhinitis in swine

    • Prevention strategies for B. bronchiseptica in laboratory animal facilities

  • One Health Approach

    • Understanding transmission between companion animals and humans

    • Environmental persistence factors related to uppP function

    • Zoonotic risk assessment based on uppP characteristics

Systematic comparative analysis of uppP across Bordetella species would provide critical information for developing targeted interventions that account for species-specific features while leveraging conserved mechanisms, ultimately improving management of these important respiratory pathogens in both human and veterinary settings .

What are the most significant unresolved questions regarding Bordetella bronchiseptica uppP that warrant future research?

Several critical unresolved questions regarding B. bronchiseptica uppP merit focused research attention:

Fundamental Biochemistry and Structure:

  • Detailed Structural Characterization

    • What is the high-resolution structure of B. bronchiseptica uppP?

    • How does substrate binding induce conformational changes during catalysis?

    • What structural features distinguish it from homologs in other bacteria?

  • Catalytic Mechanism Elucidation

    • What is the precise chemical mechanism of UPP dephosphorylation?

    • How is proton transfer coordinated during catalysis?

    • Are there metal cofactor requirements specific to B. bronchiseptica uppP?

Physiological Role and Regulation:

  • Cell Wall Homeostasis

    • Does B. bronchiseptica possess functional redundancy in UPP phosphatases similar to B. subtilis?

    • How is uppP expression regulated during different growth phases and stress conditions?

    • What is the spatial distribution of uppP within the bacterial cell?

  • Interplay with Other Cellular Processes

    • How does uppP activity coordinate with other steps in peptidoglycan synthesis?

    • What protein-protein interactions modulate uppP function?

    • How do membrane composition changes affect uppP activity?

Pathogenesis and Host Interaction:

  • Virulence Contribution

    • How does uppP function impact B. bronchiseptica virulence in different hosts?

    • Is uppP activity modulated during specific stages of infection?

    • Does uppP play a role in immune evasion strategies?

  • Biofilm Formation and Persistence

    • How does uppP contribute to biofilm formation and maintenance?

    • Is uppP involved in the development of persister cells during antibiotic treatment?

    • Does uppP function change during chronic infection establishment?

Therapeutic Applications:

  • Drug Discovery Challenges

    • What chemical scaffolds can selectively inhibit B. bronchiseptica uppP?

    • How can the membrane-embedded nature of uppP be addressed in inhibitor design?

    • What delivery systems can effectively target uppP inhibitors to the bacterial cell envelope?

  • Immune Recognition and Vaccination

    • Can uppP serve as an effective antigen in vaccine formulations?

    • What epitopes are accessible to the immune system during infection?

    • How does pre-existing immunity to uppP affect infection outcomes?

These unresolved questions represent critical knowledge gaps that, when addressed, will significantly advance our understanding of B. bronchiseptica biology and potentially reveal new therapeutic opportunities for managing infections caused by this important respiratory pathogen .

What methodological advances would accelerate progress in Bordetella bronchiseptica uppP research?

Several methodological advances would significantly accelerate progress in B. bronchiseptica uppP research:

Genetic Tool Development:

  • Refined Gene Modification Systems

    • CRISPR-Cas9 optimization for efficient genome editing in Bordetella

    • Development of landing pad systems for controlled integrations

    • Inducible promoter systems with wider dynamic ranges and tighter regulation

    • Transposon sequencing (Tn-Seq) libraries for global genetic interaction mapping

  • Reporter Systems

    • Fluorescent and luminescent reporters for real-time uppP expression monitoring

    • Split reporter systems for protein-protein interaction studies

    • Cell envelope stress biosensors similar to P₍σᴹ₎ reporters in B. subtilis

    • In vivo activity probes for UPP phosphatase function

Structural Biology Advancements:

  • Membrane Protein Structure Determination

    • Cryo-EM methodologies optimized for smaller membrane proteins

    • Novel detergents and nanodiscs for uppP stabilization

    • Microcrystal electron diffraction for structure determination without large crystals

    • Improved computational methods for membrane protein modeling and refinement

  • Dynamic Structural Analysis

    • Time-resolved structural methods capturing catalytic intermediates

    • Single-molecule FRET approaches for conformational dynamics

    • Hydrogen-deuterium exchange mass spectrometry optimized for membrane proteins

    • Advanced NMR methodologies for membrane-embedded enzymes

Biochemical and Biophysical Approaches:

  • Enzyme Assay Improvements

    • Development of real-time continuous assays for UPP phosphatase activity

    • High-throughput compatible systems for inhibitor screening

    • Synthetic substrate analogs with improved properties

    • Label-free detection methods for monitoring activity

  • Protein-Lipid Interaction Analysis

    • Native mass spectrometry methods for membrane protein-lipid complexes

    • Advanced microscopy techniques for membrane microdomain analysis

    • Lipid-protein interaction mapping technologies

    • Microfluidic platforms for membrane reconstitution studies

Infection Models and Translational Tools:

  • Refined Animal Models

    • Development of humanized mouse models for B. pertussis/B. bronchiseptica

    • Advanced imaging to track infection progression in vivo

    • Organoid technologies for species-specific respiratory tissue models

    • Multi-omics approaches for host-pathogen interaction analysis

  • Translational Research Acceleration

    • High-throughput screening systems in physiologically relevant conditions

    • ML/AI approaches for predicting uppP inhibitor efficacy

    • Fragment-based drug discovery platforms optimized for membrane targets

    • Vaccine antigen delivery systems with improved immunogenicity

Technological Integration Framework:

Methodological AreaCurrent LimitationsProposed AdvancesExpected Impact
Genetic manipulationLimited toolbox for BordetellaCRISPR systems, inducible expressionPrecise functional studies
Structural analysisMembrane protein challengesCryo-EM, advanced modelingRational drug design capability
Activity assaysLow throughput, complex substratesContinuous, HTS-compatible methodsAccelerated inhibitor discovery
In vivo analysisLimited infection monitoringAdvanced imaging, biomarkersImproved translation to clinical applications

These methodological advances would collectively overcome current technical barriers and accelerate progress in understanding B. bronchiseptica uppP biology, ultimately facilitating the development of novel therapeutic strategies .

How might integrating uppP research with broader cell envelope biology advance our understanding of bacterial pathogens?

Integrating uppP research with broader cell envelope biology would create synergistic insights that advance understanding of bacterial pathogens in several key dimensions:

Systems-Level Cell Envelope Homeostasis:

  • Lipid II Cycle Integration

    • Understanding uppP's role within the complete peptidoglycan synthesis pathway

    • Identification of rate-limiting steps and regulatory checkpoints

    • Elucidation of substrate channeling mechanisms between pathway components

    • Mapping of protein complexes that spatially organize cell wall synthesis

  • Coordination with Other Envelope Biosynthetic Pathways

    • Cross-talk between peptidoglycan, lipopolysaccharide, and membrane lipid synthesis

    • Shared precursors and competing metabolic demands

    • Temporal regulation during cell cycle progression

    • Response to environmental stressors affecting multiple pathways simultaneously

Stress Response Network Integration:

  • Cell Envelope Stress Response Circuits

    • UppP's position in stress sensing and response mechanisms

    • Integration with ECF sigma factor networks as observed in B. subtilis

    • Connections to two-component systems monitoring envelope integrity

    • Feedback loops controlling uppP expression under different stress conditions

  • Global Regulatory Networks

    • Links between cell envelope homeostasis and virulence regulation

    • Integration with quorum sensing systems

    • Connections to nutritional stress responses

    • Coordination with oxidative stress defense mechanisms

Host-Pathogen Interface Perspectives:

  • Immune Recognition Determinants

    • How cell envelope components shaped by uppP activity trigger immunity

    • Species-specific adaptations in envelope composition affecting host recognition

    • Evasion strategies linked to modifications in cell envelope structures

    • Evolution of host immune receptors targeting conserved envelope components

  • Therapeutic Targeting Strategies

    • Multi-target approaches affecting synergistic envelope biosynthetic steps

    • Identification of vulnerability nodes within envelope homeostasis networks

    • Rationale for combination therapies based on pathway interdependencies

    • Potential for host-directed therapies that amplify envelope stress

Comparative Biology Framework:

  • Evolutionary Perspective on Envelope Biology

    • Comparison across diverse bacterial pathogens reveals conserved principles

    • Identification of species-specific adaptations in envelope biosynthesis

    • Co-evolution of envelope components with host environments

    • Horizontal gene transfer patterns affecting envelope diversity

  • Biotechnological Applications

    • Engineered envelope properties for vaccine development

    • Controlled permeability for drug delivery applications

    • Biosensors exploiting envelope stress pathways

    • Synthetic biology approaches to novel envelope architectures

Integrated Research Outcomes:

Research AreaSpecific Integration PointExpected Scientific Advance
Structural biologyUppP interaction with other envelope proteinsMultiprotein complex architecture understanding
MetabolomicsLipid intermediates affected by uppP functionMetabolic flux mapping during infection
ProteomicsUppP-dependent envelope protein expressionStress response network reconstruction
ImmunologyEnvelope composition effects on immune activationNovel immunomodulatory approaches
Synthetic biologyEngineered uppP variants with altered functionDesigner cell envelopes for biotechnology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.