Recombinant Bordetella pertussis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Bordetella pertussis ATP synthase subunit a (atpB) refers to the recombinant production of the α-subunit of the ATP synthase complex in B. pertussis. ATP synthase is a critical enzyme for bacterial energy production, catalyzing ATP synthesis via proton motive force across cellular membranes. Subunit a is part of the transmembrane F₀ subcomplex, forming proton channels and interacting with the F₁ subcomplex to drive ATP synthesis .

Potential Roles in B. pertussis Pathogenesis

  • Energy Metabolism: ATP synthase is essential for maintaining cellular energy homeostasis, particularly during infection. B. pertussis relies on ATP synthase for colonization and toxin secretion (e.g., pertussis toxin) .

  • Antibiotic Targets: ATP synthase inhibitors (e.g., bedaquiline) disrupt bacterial energy production. Recombinant atpB could aid in studying drug resistance mechanisms or identifying novel targets .

Methodological Challenges

Recombinant atpB production in B. pertussis faces challenges due to:

  • Low Expression in Native Hosts: B. pertussis often requires heterologous systems (e.g., E. coli) for efficient protein expression, as seen with fimbriae and pertussis toxin .

  • Post-Translational Modifications: Proper folding and membrane integration of subunit a may require chaperones or specific host environments .

Data Gaps and Future Directions

AspectCurrent StatusFuture Research Needs
Structural CharacterizationLimited 3D structural data for B. pertussis atpB; homologs (e.g., H. pylori) provide partial insights .Cryo-EM or X-ray crystallography of recombinant atpB.
Functional StudiesNo direct studies on B. pertussis atpB; inferred roles from ATP synthase function in other pathogens.Mutagenesis to map proton channel residues.
Therapeutic PotentialATP synthase inhibitors are understudied in B. pertussis; no reported atpB-specific inhibitors.High-throughput screening for atpB-binding compounds.

Comparison with Related Proteins

ProteinFunctionRelevance to B. pertussis
Pertussis Toxin (PT)ADP-ribosyltransferase; subverts host signaling .Shares secretion pathways (e.g., Ptl system) .
Adenylate Cyclase Toxin (ACT)Elevates cAMP; suppresses host immune responses .Co-regulated with ATP synthase in stress responses .
PtlHATPase component of PT secretion system .Requires ATP for toxin secretion, linking energy metabolism to virulence.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing it based on your specification.
Synonyms
atpB; BP3282; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Target Names
atpB
Target Protein Sequence
MAAPSGASPQSEYIQHHLVHLNNIGEKQSVIAQFNVINYDSLFWSILMGLLVVFCLWLAA RRATAGVPGRFQGFIEMIVDMVDDQAKSIVTNAKSRLFVAPLALTVFLWIILMNALDLLP VDLLPSIWRMTGLGAEHGDPLYYHRILPTADLNVPMGMSLGVLLLMFYYGIKIKHPGGFV KELFTAPFHAHGLASLVLAPFNLLLNLIEYAAKSVSLGMRLFGNMFAGELIFMLIALLGG AWTGFNGASIGLGIGHVLAGSVWAIFHILIVLLQAFIFMMLTLVYIGQAHEGH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It directly participates in the translocation of protons across the membrane.
Database Links

KEGG: bpe:BP3282

STRING: 257313.BP3282

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression systems for recombinant B. pertussis atpB production?

The choice of expression system for recombinant B. pertussis atpB depends on research objectives and desired protein characteristics. While E. coli expression systems offer simplicity and high yields, they often fail to produce native conformations of Bordetella proteins due to differences in post-translational modification pathways. Studies have demonstrated that closely related Bordetella species such as B. parapertussis and B. bronchiseptica can serve as more suitable hosts for expressing recombinant B. pertussis proteins in their native conformation . When expressing atpB, consider the following systems:

  • Homologous expression (within other Bordetella species) - Preserves native protein structure and folding

  • E. coli with optimized codons and specific translation initiation regions (TIRs)

  • Cell-free protein synthesis systems for difficult-to-express membrane proteins

The choice between these systems should be guided by whether functional activity or structural studies are prioritized in your research.

How do native versus heterologous promoters affect atpB expression levels?

The selection of promoters significantly impacts expression levels of recombinant atpB. Research has shown that B. pertussis native promoters function effectively in related Bordetella species, while E. coli promoters show variable efficacy across Bordetella species . A comparative analysis reveals:

Promoter TypeExpression in B. parapertussisExpression in B. bronchisepticaNotes
Native B. pertussisHighHighOptimal for maintaining native expression patterns
E. coli PLACMinimal/NoneModerateFunctions in B. bronchiseptica but not B. parapertussis
Lambda PL/PRNoneNoneNot effective in either species

For atpB expression, the distance between transcription start site and translation start codon must be optimized, as seen with other B. pertussis proteins where this distance can be substantial (e.g., 146 nucleotides for fimbrial proteins) . Using the native B. pertussis promoter with its Shine-Dalgarno sequence typically yields the highest expression levels across Bordetella species.

What challenges are associated with expressing membrane-associated proteins like atpB?

ATP synthase subunit a (atpB) presents specific challenges as a membrane-associated protein:

  • Hydrophobicity and membrane integration requirements can lead to protein aggregation or misfolding

  • Potential toxicity to host cells when overexpressed

  • Difficulty in purification while maintaining native conformational states

  • Requirement for appropriate membrane mimetics during purification and analysis

Successful expression strategies often involve using lower induction temperatures (16-20°C), specialized E. coli strains designed for membrane proteins (C41/C43), or utilizing mild detergents like DDM (n-Dodecyl β-D-maltoside) during extraction. For functional studies, reconstitution into proteoliposomes may be necessary to maintain the protein's native environment.

How can reporter systems be designed to monitor atpB expression and localization?

Developing effective reporter systems for atpB requires strategies that accommodate its membrane localization:

  • C-terminal fusion tags (His, FLAG, or GFP variants) with flexible linkers to minimize interference with membrane insertion

  • Split GFP systems where the 11th β-strand of GFP is fused to atpB and complemented by the remainder of GFP in the cytoplasm

  • Inducible promoter systems to control expression timing

For microscopy-based localization studies, consider using specialized GFP variants that fold efficiently in the periplasmic or membrane environment. When designing reporter constructs for atpB, it's critical to verify that fusion proteins maintain proper membrane integration and function, as incorrect folding can redirect proteins to inclusion bodies.

What are the critical parameters for optimizing atpB purification while maintaining native structure?

Purification of membrane proteins like atpB requires careful consideration of extraction and purification conditions:

ParameterRecommended ApproachRationale
Detergent selectionMild detergents (DDM, LMNG)Maintain protein-protein interactions within ATP synthase complex
Buffer composition25-50 mM Tris-HCl pH 8.0, 100-300 mM NaCl, 5-10% glycerolStabilize extracted protein
Temperature4°C throughout purificationMinimize proteolytic degradation
Purification strategyTwo-step: affinity chromatography followed by size exclusionRemove impurities while maintaining native oligomeric state
ReconstitutionGradual detergent removal by dialysis or biobeadsAllow proper refolding into lipid bilayers

For structural studies requiring higher purity, consider incorporating an ion exchange chromatography step between affinity and size exclusion steps. The presence of appropriate lipids (typically E. coli polar lipid extract at 10:1 lipid:protein ratio) during purification can significantly enhance stability and activity of the purified atpB.

How can isotope labeling of recombinant atpB be optimized for structural studies?

For researchers pursuing NMR or mass spectrometry studies of atpB:

  • Minimal media formulations must be optimized to achieve sufficient cell density while incorporating isotope-labeled precursors

  • Expression in deuterated media requires adaptation periods for host cells

  • Selective labeling strategies can focus on specific amino acids involved in functional regions

An effective approach combines SILAC (Stable Isotope Labeling by Amino acids in Cell culture) techniques with controlled expression timing. Begin with a pre-culture in rich media, then transfer to minimal media containing isotope-labeled precursors, followed by a short adaptation period before induction. This methodology has been successfully applied to other membrane proteins from pathogenic bacteria and can be adapted for atpB studies.

What assays can determine if recombinant atpB assembles correctly within the ATP synthase complex?

Assessing proper assembly of recombinant atpB within the ATP synthase complex requires multiple complementary approaches:

  • Blue Native PAGE to analyze intact complex formation

  • ATP hydrolysis assays comparing activity of complexes with recombinant versus native atpB

  • Proton pumping assays using pH-sensitive fluorophores in reconstituted proteoliposomes

  • Cross-linking studies followed by mass spectrometry to verify interaction partners

When properly assembled, atpB should demonstrate interactions with other ATP synthase subunits and contribute to proton translocation coupled to ATP synthesis/hydrolysis. Comparison with known ATP synthase inhibitors (oligomycin, DCCD) can provide further evidence of functional integration, as properly assembled complexes will show characteristic inhibition patterns.

How does the membrane environment affect atpB function and what systems best replicate native conditions?

The membrane environment critically impacts atpB function since it forms part of the proton channel in ATP synthase. Research on membrane proteins indicates:

  • Lipid composition affects protein lateral mobility and conformational changes

  • Membrane thickness influences hydrophobic matching with transmembrane domains

  • Presence of specific lipids (cardiolipin, phosphatidylethanolamine) can be essential for function

For functional studies, reconstructed systems should mimic the native Bordetella membrane environment. While exact lipid compositions for B. pertussis membranes are not fully characterized, systems using E. coli polar lipid extract supplemented with 10-20% cardiolipin have proven effective for other bacterial ATP synthases. Nanodiscs containing defined lipid compositions offer advantages for controlled studies of lipid effects on atpB function.

What approaches can distinguish between functional differences of recombinant atpB versus native protein?

To rigorously compare recombinant and native atpB:

  • Site-directed mutagenesis of conserved residues should produce similar functional effects in both proteins

  • Thermal stability profiles measured by differential scanning calorimetry can reveal differences in folding quality

  • Hydrogen-deuterium exchange mass spectrometry can identify regions with altered conformational dynamics

  • Inhibitor binding profiles and kinetics should match between native and recombinant forms

Additionally, cryo-EM structural analysis of ATP synthase complexes containing either native or recombinant atpB can provide direct visualization of any structural differences. When designing such comparative studies, it's essential to purify both proteins using identical methods to eliminate methodological variables.

How can recombinant atpB be used to study ATP synthase regulation during B. pertussis pathogenesis?

Recombinant atpB provides a valuable tool for studying metabolic adaptation during infection:

  • Tagged versions can monitor expression levels during different growth conditions mimicking host environments

  • Mutational analysis can identify regions involved in regulatory protein-protein interactions

  • In vitro reconstitution with regulatory factors can elucidate control mechanisms

Research on other pathogens has shown that ATP synthase regulation is often linked to virulence factor expression through shared regulatory networks . For B. pertussis, the relationship between energy metabolism and toxin production represents an important research area. Studies using recombinant atpB can help determine if ATP synthase activity serves as a metabolic checkpoint for virulence factor production, similar to what has been observed with pertussis toxin regulation .

What role does atpB play in bacterial persistence and antibiotic tolerance?

The ATP synthase complex, including atpB, is increasingly recognized as important for bacterial persistence:

  • During nutrient limitation, bacteria often downregulate ATP synthase to minimize energy expenditure

  • Some antibiotics require active metabolism for efficacy, making ATP synthase regulation relevant to tolerance mechanisms

  • Membrane potential maintenance, partially regulated by ATP synthase activity, affects susceptibility to certain antimicrobials

Recombinant atpB variants can be used to create strains with altered ATP synthase activity to study these phenomena. By combining controlled expression systems with metabolic measurements, researchers can establish causative relationships between energy metabolism and persistence phenotypes in B. pertussis.

How can structural studies of atpB contribute to developing novel antimicrobials?

ATP synthase has emerged as a potential antibiotic target, with atpB forming part of the critical proton channel:

  • High-resolution structures of atpB can identify unique pockets absent in human homologs

  • Fragment-based screening against purified recombinant atpB can identify initial chemical scaffolds

  • Mutations in atpB affecting antibiotic binding sites can provide resistance mechanisms information

While bedaquiline (targeting mycobacterial ATP synthase) demonstrates the viability of ATP synthase as an antibiotic target, species-specific differences in ATP synthase structure are critical for developing selective inhibitors. Recombinant B. pertussis atpB provides the necessary material for structural and biochemical studies to identify unique features that could be exploited for selective targeting.

What techniques are most effective for identifying protein-protein interactions involving atpB?

Membrane proteins like atpB require specialized approaches for interaction studies:

  • Membrane-based yeast two-hybrid systems that allow interaction detection within membrane environments

  • Proximity labeling using BioID or APEX2 fused to atpB to identify nearby proteins in vivo

  • Co-immunoprecipitation with crosslinking to capture transient interactions

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

For ATP synthase components, chemical crosslinking followed by mass spectrometry has proven particularly valuable in identifying interaction regions between subunits. When applying these techniques to B. pertussis atpB, expression levels must be carefully controlled to avoid artifacts from overexpression, which can disrupt normal stoichiometry within the ATP synthase complex.

How can recombinant atpB expression systems be designed to study energy coupling during toxin secretion?

Energy dependency of toxin secretion systems can be studied using recombinant atpB variants:

  • Develop expression systems with tunable atpB activity through directed mutagenesis

  • Create reporter systems that simultaneously monitor ATP synthase activity and toxin secretion

  • Establish reconstituted systems combining purified recombinant atpB with secretion apparatus components

In B. pertussis, toxin secretion systems require energy input that may directly or indirectly depend on ATP synthase activity . Experimental designs should include measurements of membrane potential, ATP levels, and proton motive force alongside quantification of toxin secretion. Comparing wild-type atpB with mutant variants can establish the specific contributions of ATP synthase to secretion energetics.

What are the methodological considerations for analyzing post-translational modifications of atpB?

Post-translational modifications (PTMs) of bacterial ATP synthase components are increasingly recognized as regulatory mechanisms:

  • Phosphorylation and acetylation can be detected using modification-specific antibodies or mass spectrometry

  • Enrichment strategies for modified peptides are essential due to substoichiometric modification levels

  • Site-directed mutagenesis of modified residues can establish functional significance

To comprehensively analyze PTMs on recombinant atpB, consider:

PTM TypeDetection MethodEnrichment StrategyControl/Validation
PhosphorylationLC-MS/MSTiO₂ or IMACLambda phosphatase treatment
AcetylationLC-MS/MSAnti-acetyllysine antibodiesDeacetylase treatment
S-NitrosylationBiotin switch techniqueStreptavidin pulldownAscorbate dependence
OxidationLC-MS/MSNo specific enrichmentReduction/oxidation controls

When comparing PTM patterns between native and recombinant atpB, consider that expression host and growth conditions significantly impact modification profiles, requiring careful experimental design to distinguish biologically relevant modifications from artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.