Recombinant Bordetella pertussis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction and Definition

Recombinant Bordetella pertussis glycerol-3-phosphate acyltransferase (plsY) is a bioengineered enzyme produced via heterologous expression in Escherichia coli. It corresponds to the native B. pertussis protein encoded by the BP1718 gene (UniProt ID: Q7VXN3) and functions as a glycerol-3-phosphate acyltransferase (GPAT) or lysophosphatidic acid (LPA) synthase . This enzyme catalyzes the first committed step in phospholipid biosynthesis, converting glycerol-3-phosphate (G3P) into LPA, a precursor for membrane phospholipids and signaling molecules .

Table 1: Functional and Biochemical Characteristics of plsY

PropertyDetailSource
Enzyme ActivityConverts glycerol-3-phosphate to lysophosphatidic acid (LPA)
Substrate SpecificityUtilizes acyl-CoA derivatives (e.g., palmitoyl-CoA)
Pathway IntegrationFeeds into phospholipid biosynthesis and membrane lipid assembly
Regulatory ContextCoordinated with PPP-derived precursors for lipopolysaccharide (LOS) biosynthesis

Recombinant Production and Characteristics

The recombinant plsY is engineered for structural and functional studies. Key features include:

  • Expression System: Produced in E. coli with an N-terminal His-tag for purification .

  • Protein Specifications:

    • Length: Full-length (1–215 amino acids).

    • Purity: >90% as determined by SDS-PAGE .

    • Stability: Lyophilized powder stored at -20°C/-80°C; repeated freeze-thaw cycles avoided .

  • Reconstitution: Dissolved in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

Research Applications and Findings

While plsY has not been extensively studied in B. pertussis, its recombinant form enables:

  • Biochemical Assays: Studying enzymatic activity (e.g., LPA production kinetics) or inhibitor screening .

  • Structural Biology: Mapping substrate-binding residues or catalytic motifs (e.g., conserved motifs in GPAT homologs) .

  • Vaccine Development: Exploring lipid-based antigens, though current acellular vaccines prioritize protein antigens (e.g., pertussis toxin, pertactin) .

Key Challenges

  • Limited Functional Data: No direct studies link plsY to B. pertussis virulence or vaccine efficacy.

  • Post-Translational Modifications: E. coli-expressed plsY may lack modifications critical for native function (e.g., glycosylation) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary based on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
plsY; BP1718; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Target Names
plsY
Target Protein Sequence
MPATMVLTAPSLLSSSALIVLAYLIGSIPFAVVVSKLMGLQDPRSYGSGNPGATNVLRTG NKTAAALTLLGDAAKGWFALWLARALVPELSWGAYALVALAVFLGHLYPLFLRFKGGKGV ATALGVLMAIEPWLAVATIATWLIVAVFSRYSSLAALVAAFFAPVYYVFGSGAAWHARLE VGLAIAVISALLFYRHRANIARLLKGTESRIGKKK
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: bpe:BP1718

STRING: 257313.BP1718

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bordetella pertussis and why is plsY significant?

Bordetella pertussis is a Gram-negative, aerobic, pathogenic, encapsulated coccobacillus bacterium of the genus Bordetella, and the causative agent of pertussis or whooping cough in humans. Its complete genome of 4,086,186 base pairs was published in 2003, revealing a reduced genome size compared to related species like B. bronchiseptica, reflecting its adaptation to a single host species (humans) .

Glycerol-3-phosphate acyltransferase (plsY) is an important enzyme involved in phospholipid biosynthesis, specifically in the first step of the pathway leading to phosphatidic acid formation. In B. pertussis, plsY (Uniprot ID: Q7VXN3) consists of 215 amino acids and functions in membrane lipid biosynthesis, which is essential for bacterial cell viability and potentially involved in virulence .

How does plsY function in bacterial phospholipid synthesis?

Glycerol-3-phosphate acyltransferase (G3PAT/plsY) catalyzes the acylation of glycerol-3-phosphate, which represents the first committed step in phospholipid biosynthesis. Based on studies in other systems, plsY specifically transfers an acyl group from acyl-phosphate to the sn-1 position of glycerol-3-phosphate to form lysophosphatidic acid . This reaction is critically important as phospholipids are essential components of bacterial membranes.

The enzyme likely functions with an apparent Km for glycerol-3-phosphate that can be modulated under different physiological conditions. While specific kinetic parameters for B. pertussis plsY are not established in the provided literature, studies on homologous enzymes suggest the activation mechanism may involve changes in Km rather than Vmax, indicating an alteration in substrate affinity rather than catalytic rate .

What expression systems are optimal for producing recombinant B. pertussis proteins?

Based on successful recombinant protein production for other B. pertussis antigens, E. coli expression systems have proven effective for bacterial proteins. For instance, pertactin (Prn), fimbriae 2 (Fim2), and fimbriae 3 (Fim3) have been successfully expressed with yields of 12-25 mg/L . Similar approaches can be adapted for plsY expression.

When expressing membrane proteins like plsY, several considerations are critical:

  • Expression vector selection: pET-series vectors with T7 promoters often provide high-level expression for bacterial proteins

  • Host strain optimization: BL21(DE3) derivatives or C41/C43 strains designed for membrane protein expression

  • Induction conditions: Lower temperatures (16-20°C) and reduced IPTG concentrations can improve folding

  • Solubilization strategies: Membrane proteins require detergents for extraction and purification

For purification of recombinant plsY, affinity chromatography using histidine tags offers efficient one-step purification, though the tag placement requires optimization to maintain enzymatic activity .

How can recombinant plsY be characterized to confirm proper folding and activity?

Multiple complementary approaches should be employed to verify the structural integrity and functionality of recombinant plsY:

Characterization MethodPurposeTechnical Considerations
SDS-PAGE and Western BlotPurity and identity confirmationUse anti-His antibodies or custom antibodies against plsY
Circular DichroismSecondary structure analysisRequires careful buffer selection compatible with CD measurements
Size Exclusion ChromatographyOligomeric state assessmentNeed to account for detergent micelles in analysis
Enzyme Activity AssayFunctional verificationMonitor acyltransferase activity by measuring lysophosphatidic acid formation
Thermal Shift AssayProtein stability analysisFluorescent dyes may interact with detergent micelles

For enzyme activity assays specifically, acyltransferase activity can be measured using radiolabeled substrates or coupled enzyme assays that track either glycerol-3-phosphate consumption or lysophosphatidic acid formation .

What role might plsY play in B. pertussis virulence and pathogenesis?

While the specific role of plsY in B. pertussis virulence has not been directly established in the provided literature, several lines of evidence suggest potential contributions to pathogenesis:

  • Membrane composition affects bacterial surface properties that influence host-pathogen interactions

  • Phospholipid biosynthesis is essential for bacterial growth and adaptation during infection

  • Membrane lipids interact with and influence the function of known virulence factors

B. pertussis contains several well-characterized virulence factors including pertussis toxin, adenylate cyclase toxin, filamentous hemagglutinin, pertactin, fimbria, and tracheal cytotoxin . The proper membrane localization and function of these factors may depend on the phospholipid composition determined in part by plsY activity.

Research approaches to investigate plsY's role in virulence could include:

  • Conditional knockdown strains to assess impact on growth and virulence factor expression

  • Lipidomic analysis during infection to track phospholipid composition changes

  • Interactions between plsY and known virulence factor complexes

Could plsY serve as a potential target for new antimicrobial therapies?

As an essential enzyme in phospholipid biosynthesis, plsY represents a potential target for novel antimicrobial development against B. pertussis. Several attributes make it attractive as a drug target:

  • Essential function in bacterial membrane synthesis

  • Absence of direct homologs in human metabolism

  • Surface accessibility for potential inhibitor binding

  • Conserved active site among bacterial species

Drug discovery strategies might include:

  • High-throughput screening against recombinant plsY to identify inhibitors

  • Structure-based design using homology models or experimental structures

  • Fragment-based approaches targeting the enzyme active site

  • Repositioning of known phospholipid biosynthesis inhibitors

The development of plsY inhibitors could potentially address issues with current treatment approaches, including antibiotic resistance concerns in B. pertussis.

What are the optimal conditions for storage and handling of recombinant plsY?

Based on general recombinant protein handling principles and specific information for B. pertussis recombinant proteins, the following storage conditions are recommended:

  • Short-term storage (1 week): 4°C in appropriate buffer

  • Long-term storage: -20°C or preferably -80°C in buffer containing 50% glycerol

  • Avoid repeated freeze-thaw cycles, as these can reduce enzyme activity

  • Store working aliquots at 4°C for up to one week

The recommended storage buffer for recombinant plsY is typically a Tris-based buffer supplemented with 50% glycerol, with pH optimized for protein stability . For membrane proteins like plsY, inclusion of appropriate detergents at concentrations above their critical micelle concentration is essential to maintain solubility and prevent aggregation.

What purification strategies are most effective for recombinant plsY?

Purification of recombinant plsY presents challenges due to its membrane-associated nature. A multi-step purification protocol is typically required:

  • Cell lysis: Mechanical disruption (sonication or French press) in buffer containing protease inhibitors

  • Membrane fraction isolation: Ultracentrifugation to separate cytosolic and membrane fractions

  • Solubilization: Detergent extraction (commonly with n-dodecyl-β-D-maltoside or LDAO)

  • Affinity chromatography: Initial capture using His-tag affinity if incorporated

  • Ion exchange chromatography: Further purification based on charge properties

  • Size exclusion chromatography: Final polishing step and buffer exchange

Throughout purification, it's essential to monitor enzyme activity to ensure the native conformation is maintained. Yield optimization often requires testing multiple detergents and buffer conditions to maximize protein stability and activity.

How can immunological methods be used to study recombinant plsY?

Immunological approaches provide valuable tools for detection, localization, and functional analysis of plsY:

  • Antibody generation: Custom antibodies against purified recombinant plsY or specific peptides can be developed for various applications

  • Western blotting: Detection of plsY expression levels under different conditions

  • Immunofluorescence microscopy: Localization studies to confirm membrane distribution

  • Immunoprecipitation: Identification of protein-protein interactions

When developing antibodies against B. pertussis proteins, both polyclonal and monoclonal approaches have proven successful. Studies with other B. pertussis recombinant proteins show that immunization with recombinant proteins induces both humoral and cellular immune responses, with IgG antibody responses and T cell responses characterized by increased production of IL-2 and TNF-α .

What approaches can be used to investigate the structure-function relationship of plsY?

Understanding the structure-function relationship of plsY requires multiple complementary approaches:

  • Computational analysis:

    • Homology modeling based on related acyltransferases

    • Molecular dynamics simulations to predict substrate binding

    • Sequence conservation analysis to identify potential functional residues

  • Experimental approaches:

    • Site-directed mutagenesis of predicted catalytic and substrate-binding residues

    • Truncation constructs to identify minimal functional domains

    • Chimeric proteins with homologs to identify specificity determinants

  • Structural biology techniques:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for structure determination

    • NMR spectroscopy for dynamics studies of soluble domains

While challenging for membrane proteins, these approaches can provide insights into the catalytic mechanism, substrate specificity, and potential inhibitor binding sites of plsY, informing both basic understanding and applied drug development efforts.

How does plsY compare across different Bordetella species?

Comparative analysis of plsY across Bordetella species can provide insights into evolutionary adaptation and potential functional specialization. The genus Bordetella contains nine species, including B. pertussis, B. parapertussis, B. bronchiseptica, B. avium, B. hinzii, B. holmesii, B. trematum, B. ansorpii, and B. petrii .

B. pertussis has undergone significant genome reduction compared to related species like B. bronchiseptica, reflecting its adaptation to the human host . This specialization may affect the structure and function of plsY and other proteins involved in essential cellular processes.

Research questions in this area include:

  • Conservation of key catalytic residues across Bordetella species

  • Differences in substrate specificity that might reflect adaptation to different host environments

  • Expression levels and regulation of plsY in different species and growth conditions

Could recombinant plsY be useful in diagnostic or vaccine development?

While plsY itself has not been specifically studied as a vaccine antigen, other recombinant B. pertussis proteins have shown promise in vaccine development. For example, recombinant pertactin (Prn) has demonstrated protective efficacy in mouse infection models .

The characteristics that would determine plsY's potential utility in vaccines include:

  • Surface accessibility

  • Conservation across circulating strains

  • Immunogenicity

  • Ability to induce protective immunity

Studies with other B. pertussis recombinant proteins have shown that proper immunological characterization is essential, including assessment of both humoral and cellular immune responses. For instance, researchers found that antibody responses increased significantly in mice immunized with recombinant Prn, and immunization also induced a Th1 response characterized by enhanced production of IL-2 and TNF-α .

Murine intranasal and intracerebral challenge assays have been validated and used to demonstrate the protection of pertussis vaccines , and similar approaches could be used to evaluate any potential protective effect of recombinant plsY-based vaccine candidates.

What are the common challenges in expressing active recombinant plsY?

Researchers often encounter several challenges when attempting to express active recombinant membrane proteins like plsY:

ChallengePotential Solutions
Low expression levelsOptimize codon usage, try different promoters, use specialized host strains
Inclusion body formationLower induction temperature, reduce inducer concentration, co-express chaperones
Protein misfoldingExpression as fusion protein, periplasmic targeting, inclusion of specific detergents
Toxicity to host cellsUse tightly regulated expression systems, leaky expression control
Loss of activity during purificationScreen multiple detergents, include stabilizing additives, maintain cold temperatures

For membrane proteins specifically, the choice of detergent is critical. A systematic screen of different detergents at varying concentrations can help identify conditions that maintain the protein in a native-like, functionally active state.

How can enzyme activity assays for plsY be optimized?

Optimizing activity assays for plsY requires consideration of several factors:

  • Substrate availability: Commercial acyl-phosphates may not be readily available; enzymatic generation of these substrates may be necessary

  • Detection methods: Direct monitoring of product formation vs. coupled assays with helper enzymes

  • Assay conditions: Buffer composition, pH, ionic strength, and temperature all affect enzyme activity

  • Detergent effects: Detergents required for protein solubility may interfere with activity measurements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.