Recombinant Bordetella pertussis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Nomenclature and Identification

The Bordetella pertussis YidC protein is identified by several names in scientific literature and databases, reflecting its various functional aspects:

  • Primary designation: Membrane protein insertase YidC

  • Gene identifier: BP0495; yidC

  • Alternative names: Foldase YidC, Membrane integrase YidC, Membrane protein YidC, Inner membrane protein translocase component YidC

These multiple designations highlight the diverse roles of YidC in bacterial membrane physiology and protein processing pathways.

Expression Systems and Purification

The recombinant form of Bordetella pertussis YidC can be expressed in various host systems depending on experimental requirements and application goals. Common expression platforms include:

  • Escherichia coli

  • Yeast expression systems

  • Baculovirus-infected insect cells

  • Mammalian cell cultures

Standard purification protocols for recombinant YidC typically achieve purity levels of 85% or higher, as determined by SDS-PAGE analysis . This high purity is essential for structural studies and functional characterization experiments that require homogeneous protein preparations.

Membrane Topology and Domain Architecture

YidC proteins exhibit a conserved structural architecture across bacterial species. While specific details of the Bordetella pertussis YidC structure remain to be fully characterized, insights from homologous proteins in other bacteria provide a structural framework. The prototypical bacterial YidC consists of:

  • Six transmembrane (TM) segments spanning the bacterial inner membrane

  • A large periplasmic domain (approximately 35 kDa) positioned between TM1 and TM2

  • Cytoplasmic loops connecting various transmembrane segments

This arrangement creates a protein with both membrane-embedded regions and soluble domains that extend into the bacterial periplasm and cytoplasm, enabling interactions with substrate proteins and other components of the bacterial protein translocation machinery.

Three-Dimensional Structure

Structural studies of YidC proteins from various bacterial species have revealed important insights applicable to the Bordetella pertussis ortholog. The conserved membrane-integrated core forms a helical bundle arranged in a pentagonal pattern when viewed from the cytoplasm . This arrangement creates a specialized environment for membrane protein insertion.

Key structural features include:

  • Five conserved transmembrane domains arranged in a specific order (4-5-3-2-6 when viewed clockwise from the cytoplasm)

  • A helical hairpin between transmembrane segments 2 and 3, forming a "helical paddle domain" on the cytoplasmic membrane surface

  • A hydrophilic cavity within the transmembrane bundle that likely facilitates substrate protein insertion

This structural organization explains how YidC can create a protected environment for membrane protein integration while simultaneously allowing lateral diffusion of substrate proteins into the lipid bilayer.

Membrane Protein Integration Pathways

YidC functions through multiple pathways to facilitate membrane protein insertion in bacteria:

  1. Independent insertase activity: YidC can directly catalyze the insertion of some substrate proteins without requiring additional protein translocation components.

  2. SecYEG-dependent pathway: YidC works cooperatively with the Sec translocon to insert complex membrane proteins, particularly those with large periplasmic domains.

  3. SRP-dependent integration: YidC collaborates with the Signal Recognition Particle (SRP) pathway components, including Ffh and FtsY, for co-translational insertion of membrane proteins .

The specific pathway utilized depends on the properties of the substrate protein, particularly its hydrophobicity, size, and topology.

Ribosome Interaction and Co-translational Insertion

A critical aspect of YidC function is its ability to interact directly with translating ribosomes. Cryo-electron microscopy reconstructions of YidC-ribosome complexes have revealed:

  • Single YidC molecules interact with ribosomes at the ribosomal tunnel exit

  • This positioning allows nascent membrane proteins to be directly channeled from the ribosome into the YidC insertion site

  • The insertion site is located at the YidC protein-lipid interface, enabling lateral release of substrates into the membrane

This co-translational mode of action ensures efficient coupling between protein synthesis and membrane integration, minimizing the exposure of hydrophobic transmembrane segments to the aqueous environment.

YidC Paralogs and Functional Specialization

While some bacteria possess a single YidC protein, others have evolved multiple paralogs with specialized functions. Though specific to Streptococcus mutans rather than Bordetella pertussis, studies of YidC paralogs (YidC1 and YidC2) provide insights into potential functional diversification:

  • YidC2 works preferentially with the SRP pathway

  • YidC1 is preferred for SRP-independent Sec translocon-mediated translocation

  • Both paralogs can also function autonomously for certain substrates

  • YidC1 interacts with SecYEG/YajC components of the holotranslocon

  • Both YidC1 and YidC2 interact with chaperones like DnaK and RopA

This functional specialization demonstrates the adaptability of YidC proteins to fulfill diverse roles in bacterial membrane protein biogenesis.

Conservation Across Bacterial Species

The YidC protein family is highly conserved across bacterial species, indicating its fundamental importance in cellular physiology. Comparative genomic analyses reveal:

  • The membrane-integrated core of YidC (particularly transmembrane regions 2-5) shows the highest sequence conservation

  • The C-terminal ~200 residues of YidC are conserved in both prokaryotic and eukaryotic versions of the protein

  • The periplasmic domain shows greater variability between Gram-negative and Gram-positive bacteria

These conservation patterns highlight the essential nature of YidC's membrane protein insertion function while suggesting potential species-specific adaptations.

Eukaryotic Homologs

YidC belongs to the Oxa/Alb/YidC family of protein insertases that are conserved across all three domains of life . Eukaryotic homologs include:

  1. Oxa1: Located in the inner membrane of mitochondria, this protein facilitates the insertion of mitochondrially-encoded proteins.

  2. ALB3: Found in the thylakoid membrane of chloroplasts, where it mediates the integration of photosynthetic proteins.

The functional conservation between these proteins is demonstrated by the ability of Oxa1 to complement YidC insertase activity when expressed in E. coli , underscoring the evolutionary significance of this protein family in cellular compartmentalization and membrane protein assembly.

Research Applications

Recombinant Bordetella pertussis YidC serves as a valuable research tool for investigating fundamental aspects of bacterial membrane biology:

  • Structural studies to elucidate membrane protein insertion mechanisms

  • Investigation of bacterial pathogenesis, as membrane proteins often play crucial roles in virulence

  • Comparative analyses between different bacterial species to identify conserved and species-specific features

  • Exploration of potential antimicrobial targets, given YidC's essential role in bacterial physiology

The availability of purified recombinant YidC enables these investigations through various biochemical, biophysical, and structural biology approaches.

Biomedical Relevance

The study of Bordetella pertussis YidC has particular significance in the context of infectious disease research:

  • Bordetella pertussis is the causative agent of whooping cough, a highly contagious respiratory disease

  • Membrane proteins inserted by YidC may include virulence factors critical for bacterial pathogenesis

  • Understanding YidC function may reveal new strategies for attenuating bacterial virulence

  • YidC's essential nature makes it a potential target for novel antimicrobial development

These connections to human health underscore the importance of continued research into this membrane protein insertase.

Production of Recombinant YidC

The production of recombinant Bordetella pertussis YidC typically follows established protocols for membrane protein expression and purification:

  1. Cloning of the BP0495 gene into appropriate expression vectors

  2. Transformation into expression hosts (E. coli, yeast, baculovirus, or mammalian cells)

  3. Induction of protein expression under optimized conditions

  4. Membrane isolation and solubilization using appropriate detergents

  5. Purification via affinity chromatography and additional purification steps

  6. Quality assessment through SDS-PAGE analysis

These procedures yield recombinant protein with ≥85% purity suitable for structural and functional studies.

Functional Assays

Various experimental approaches can assess the functional properties of recombinant YidC:

  • In vitro membrane protein insertion assays using artificial liposomes

  • Complementation studies in YidC-depleted bacterial strains

  • Protein-protein interaction analyses through cross-linking and co-immunoprecipitation

  • Structural studies using X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy

  • Molecular dynamics simulations to investigate membrane interactions and protein dynamics

These diverse methodologies provide complementary insights into YidC structure and function, contributing to a comprehensive understanding of this essential membrane protein insertase.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; BP0495; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-563
Protein Length
full length protein
Species
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Target Names
yidC
Target Protein Sequence
MDIRRTVLWMIFSFSLLLLWNNWQIHNGKPSLFGGPAPEAAATQQPKADANGTAASSTAS IPSSPAAAPAAASVPGAAAPAAAKSEQVVITTDVLRLTFDSNGAQLIRAELLKYPSSSQS DKPTVLMDRSADLVYVAQTGVVGAPQGESFPTHQTPFHLVSSERSLTGDTLDVVFEAESG GLKVTKTYTLHRGRYDVDVRHAMANTGGAPLNPALYLQLERDGTDPAGTSSFYHTFTGVA VYSEQDKFQKVTFSDIEKKKGTYIKQADNGWIGIVQHYFATAWIPAQGKQRTNELLQVQQ NLYAARTIEAVGTIAPGSSANVDAHLWVGPQDQKAMAAVAPGLELVVDYGWLTIIAKPLF TLMTWLHGLLGNWGWTIVALTVIIKAVFFPLAAASYRSMARMKQVAPRLQALKEKYGDDR QKLNQAMMEMYRTEKINPLGGCLPMVVQIPVFIALYWVLLASVEMRGAPWILWVHDLSVR DPFFILPAIMMATMFLQIKLNPTPPDPVQAKVMMIMPLVFGGMMFFFPAGLVLYWCVNNT LSIAQQWTITRNLERQAAAAANR
Uniprot No.

Target Background

Function

Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. YidC is involved in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, and at least some lipoproteins. It also assists in the folding of multispanning membrane proteins.

Database Links

KEGG: bpe:BP0495

STRING: 257313.BP0495

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bordetella pertussis Membrane Protein Insertase YidC and what is its role in bacterial physiology?

Membrane protein insertase YidC (yidC) is a critical bacterial membrane protein that facilitates the insertion, folding, and assembly of membrane proteins in Bordetella pertussis. It functions as a membrane integrase and foldase (also known as Foldase YidC or Membrane integrase YidC), playing an essential role in the biogenesis of integral membrane proteins. In B. pertussis, YidC is encoded by the yidC gene (locus tag BP0495) and consists of 563 amino acids . YidC helps maintain membrane integrity and function, which is vital for bacterial survival, pathogenicity, and interaction with host immune cells during infection . The protein contains transmembrane domains and cytoplasmic regions that coordinate the proper insertion of substrate proteins into the bacterial membrane, ensuring their correct orientation and folding.

How does the structure of B. pertussis YidC compare to homologous proteins in other bacterial species?

B. pertussis YidC shares structural similarities with homologous proteins found in other bacterial species, but with specific sequence variations that may influence substrate specificity and function. The protein contains hydrophobic transmembrane segments that anchor it in the membrane, along with hydrophilic regions that interact with substrate proteins. The amino acid sequence of B. pertussis YidC includes distinctive features such as a glycine-rich region (amino acids 98-129) containing multiple alanine and glycine repeats that may provide flexibility during protein insertion processes . While the core functional domains remain conserved across species, sequence conservation analysis of B. pertussis proteins reveals that membrane proteins like YidC show varying degrees of conservation across Bordetella species, with higher conservation within B. pertussis strains but lower conservation between different Bordetella species (approximately 74-78% sequence conservation for non-vaccine antigens) . These structural variations may contribute to species-specific adaptations in membrane protein biogenesis.

What is the genomic context of the yidC gene in B. pertussis and how is its expression regulated?

The yidC gene in B. pertussis is designated as BP0495 in the Tohama I strain (ATCC BAA-589/NCTC 13251) . Like many bacterial membrane proteins, YidC expression is likely regulated in response to bacterial growth phase, environmental conditions, and membrane stress. Genomic surveillance studies of B. pertussis have revealed that while certain antigens show variability across strains, core cellular machinery proteins like YidC tend to be more conserved . The regulation of yidC may involve transcriptional control mechanisms responding to membrane protein homeostasis, ensuring that YidC levels match the cellular demand for membrane protein insertion. Advanced genomic approaches, including culture-independent methods being developed for B. pertussis surveillance, could provide further insights into yidC expression patterns during infection and under different growth conditions .

What are the optimal methods for expressing and purifying recombinant B. pertussis YidC protein?

The expression and purification of recombinant B. pertussis YidC presents significant challenges due to its membrane-embedded nature. The optimal approach involves:

  • Expression System Selection: E. coli-based expression systems with specialized strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) generally yield better results than conventional strains.

  • Vector Design: Incorporating a cleavable affinity tag (His6, Strep-tag II, or MBP) at either the N- or C-terminus facilitates purification while preserving protein functionality. According to available product specifications, commercial recombinant YidC preparations typically include tag systems determined during the production process .

  • Membrane Extraction: Gentle solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin preserves protein structure and function.

  • Purification Strategy: A multi-step purification approach combining affinity chromatography, size exclusion chromatography, and ion exchange chromatography yields high-purity preparations suitable for structural and functional studies.

  • Storage Considerations: The purified protein requires stabilization in detergent micelles or reconstitution into proteoliposomes. Commercial preparations are typically stored in Tris-based buffer with 50% glycerol at -20°C or -80°C to maintain stability .

For functional studies, researchers should verify protein activity through membrane insertion assays using model substrate proteins.

How can researchers effectively design experiments to study YidC-substrate interactions in B. pertussis?

Studying YidC-substrate interactions requires specialized experimental approaches that capture the dynamic nature of membrane protein insertion. Effective experimental designs include:

  • Crosslinking Assays: Site-specific incorporation of photo-activatable crosslinkers at strategic positions within YidC can capture transient interactions with substrate proteins. Subsequent analysis by mass spectrometry identifies interaction sites and potentially novel substrates.

  • Co-immunoprecipitation Studies: Developing antibodies specific to B. pertussis YidC enables pull-down of YidC-substrate complexes from bacterial lysates. This approach works best when combined with mild solubilization conditions that preserve protein-protein interactions.

  • Fluorescence-based Interaction Assays: FRET (Förster Resonance Energy Transfer) or BRET (Bioluminescence Resonance Energy Transfer) between labeled YidC and potential substrates can provide real-time monitoring of interactions in reconstituted membrane systems.

  • In vitro Translation/Insertion Systems: Developing cell-free systems containing purified YidC in proteoliposomes allows for controlled assessment of substrate insertion efficiency and specificity.

  • Structural Biology Approaches: Cryo-electron microscopy of YidC-substrate complexes can provide atomic-level details of interaction interfaces, though this requires stabilization of these typically transient complexes.

These approaches should be complemented with controls that distinguish specific YidC-mediated insertion from spontaneous membrane integration of substrate proteins.

What immunological techniques are most effective for detecting and characterizing YidC in B. pertussis samples?

The detection and characterization of YidC in B. pertussis samples require sensitive and specific immunological techniques:

  • Antibody Development: Generation of monoclonal or polyclonal antibodies against conserved epitopes of B. pertussis YidC ensures specific detection. Epitopes from the C-terminal region (amino acids 500-563) typically show good immunogenicity while maintaining specificity .

  • Western Blotting: For bacterial lysates, optimization of membrane protein extraction using specialized detergents (CHAPS, DDM) improves detection sensitivity. Standardization with recombinant YidC controls enables semi-quantitative analysis.

  • Immunofluorescence Microscopy: Visualization of YidC localization in fixed bacterial cells provides insights into its distribution during different growth phases and infection states.

  • ELISA Systems: Sandwich ELISA approaches using capture and detection antibodies targeting different YidC epitopes offer quantitative measurement in complex samples. Commercial ELISA systems for recombinant YidC are available for standardization purposes .

  • Flow Cytometry: For intact bacteria, surface accessibility of YidC epitopes can be assessed through fluorophore-conjugated antibodies, though this approach may be limited by the predominantly membrane-embedded nature of YidC.

  • T-cell Recognition Assays: Advanced immunological characterization can include assessment of YidC as a potential T-cell antigen, similar to studies conducted for other B. pertussis proteins that have revealed broad T-cell reactivity patterns across bacterial antigens .

These techniques can be applied to both laboratory-grown cultures and clinical samples, with appropriate optimization for sample type and anticipated protein abundance.

How does YidC contribute to B. pertussis pathogenesis and host-pathogen interactions?

YidC's role in B. pertussis pathogenesis is multifaceted and involves several critical mechanisms:

  • Virulence Factor Assembly: YidC likely facilitates the insertion and assembly of membrane-associated virulence factors that mediate host-pathogen interactions. While direct evidence for specific B. pertussis virulence factors depending on YidC is limited, comparative studies with other bacterial pathogens suggest YidC may be involved in the biogenesis of adhesins, secretion system components, and immune evasion factors.

  • Maintenance of Membrane Integrity: During infection, B. pertussis faces various host defense mechanisms including antimicrobial peptides that target bacterial membranes. YidC's function in maintaining proper membrane protein composition likely contributes to membrane stability and integrity under these stress conditions.

  • Immunogenic Properties: Research on T-cell responses to B. pertussis has revealed that humans develop broad T-cell reactivity to hundreds of B. pertussis antigens, including non-vaccine antigens like membrane proteins . Whether YidC specifically contributes to this immune response profile remains to be fully characterized, but genome-wide T-cell epitope mapping approaches could identify immunogenic regions within YidC.

  • Adaptation to Host Environment: During infection, B. pertussis must adapt to the host respiratory tract environment. YidC-mediated insertion of transporters, sensors, and stress response proteins likely facilitates this adaptation, allowing the bacterium to respond to changing conditions during colonization and infection progression.

Understanding YidC's contribution to pathogenesis could identify new targets for therapeutic intervention, particularly as pertussis cases have increased despite vaccination programs .

What is the potential of YidC as a target for novel antimicrobial development against B. pertussis?

YidC represents a promising antimicrobial target for several compelling reasons:

  • Essential Function: YidC performs essential functions in membrane protein biogenesis that cannot be compensated by other cellular machinery, making it an attractive target where inhibition would likely have bactericidal effects.

  • Surface Accessibility: Certain domains of YidC are exposed to the periplasmic space, potentially accessible to antimicrobial compounds without requiring intracellular penetration.

  • Structural Distinctiveness: The structural differences between bacterial YidC and its distant eukaryotic homologs (Oxa1, Alb3) provide an opportunity for selective targeting that minimizes host toxicity.

  • Conservation and Resistance Considerations: Sequence analysis of B. pertussis proteins has shown that membrane proteins exhibit varying degrees of conservation across strains . YidC functional domains likely show higher conservation, suggesting that resistance development through mutation might compromise bacterial fitness.

Potential antimicrobial strategies targeting YidC include:

  • Small molecule inhibitors that disrupt substrate binding or conformational changes

  • Peptide-based inhibitors mimicking YidC-substrate interaction interfaces

  • Antibody-based approaches targeting accessible epitopes

  • CRISPR-Cas delivery systems targeting the yidC gene

Drug development efforts should consider the membrane-embedded nature of YidC when designing compounds with appropriate physicochemical properties for target engagement.

How can structural biology approaches enhance our understanding of B. pertussis YidC function?

Structural biology offers powerful insights into YidC function through multiple complementary approaches:

  • Cryo-Electron Microscopy (Cryo-EM): High-resolution cryo-EM can reveal the three-dimensional architecture of YidC in different functional states, including substrate-bound complexes. This technique is particularly valuable for membrane proteins like YidC that resist crystallization.

  • X-ray Crystallography: While challenging for full-length membrane proteins, crystallization of soluble domains or stabilized full-length YidC (through fusion proteins or antibody fragments) can provide atomic-resolution details of specific regions.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: Solution and solid-state NMR approaches can capture dynamic aspects of YidC function, particularly for mapping conformational changes during the substrate insertion cycle.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can map solvent-accessible regions and conformational changes in YidC under different conditions, providing insights into mechanism without requiring crystallization.

  • Molecular Dynamics Simulations: Computational modeling based on structural data can predict YidC's behavior in a lipid bilayer environment and its interactions with substrate proteins.

The amino acid sequence of B. pertussis YidC (563 residues) includes regions predicted to form transmembrane helices interspersed with hydrophilic loops . Structural studies would clarify how these elements cooperate during substrate recognition and insertion, potentially revealing species-specific features that could be exploited for targeted interventions.

What are the key considerations for designing mutation studies in B. pertussis YidC?

Designing effective mutation studies for B. pertussis YidC requires careful consideration of several factors:

  • Mutation Selection Strategy:

    • Conserved residues identified through multi-sequence alignment across Bordetella species

    • Functionally important regions based on homology to better-characterized YidC proteins

    • Residues at predicted substrate interaction interfaces

    • Amino acids unique to B. pertussis YidC compared to other bacterial species

  • Mutation Types:

    • Conservative substitutions to assess specific chemical properties

    • Alanine scanning of functional domains

    • Introduction of bulky side chains at predicted channel regions

    • Cysteine substitutions for crosslinking and accessibility studies

  • Expression Systems:

    • Complementation systems in YidC-depleted B. pertussis

    • Heterologous expression in E. coli YidC-depletion strains

    • Plasmid-based versus chromosomal integration approaches

  • Functional Assays:

    • Growth complementation under YidC depletion

    • Substrate protein insertion efficiency measurements

    • Membrane integrity assessments

    • Protein-protein interaction analysis

  • Controls:

    • Wild-type YidC expression at comparable levels

    • Mutations in non-conserved, surface-exposed residues as negative controls

    • Well-characterized mutations from other bacterial YidC homologs

When designing mutations, researchers should particularly consider the unique structural elements in B. pertussis YidC, including the glycine-rich region between amino acids 98-129, which may provide flexibility important for function .

How can researchers effectively use recombinant YidC in reconstitution experiments?

Successful reconstitution of recombinant B. pertussis YidC into model membrane systems requires optimized protocols:

  • Proteoliposome Preparation:

    • Lipid composition selection: E. coli polar lipid extract supplemented with phosphatidylglycerol provides a suitable initial mixture

    • Protein-to-lipid ratio optimization: Typically 1:100 to 1:200 (w/w) for functional studies

    • Detergent removal techniques: Dialysis (for mild detergents) or Bio-Beads adsorption (for stronger detergents)

    • Size control: Extrusion through defined pore-size membranes (100-400 nm)

  • Activity Verification Methods:

    • Substrate protein insertion assays using purified model substrates

    • Protease protection assays to confirm correct topology

    • Fluorescence-based assays to monitor conformational changes

    • Direct visualization using negative-stain electron microscopy

  • Parameter Optimization:

    • Buffer conditions (pH 7.0-8.0, physiological ionic strength)

    • Temperature (typically 25-37°C for activity measurements)

    • Inclusion of energy sources (ATP, proton motive force)

    • Time course determination for maximum activity

  • Technical Considerations:

    • Storage of proteoliposomes (4°C for short-term, flash-freezing for long-term)

    • Homogeneity assessment by dynamic light scattering

    • Orientation determination through selective proteolysis

    • Quantification of successfully incorporated YidC

The recombinant YidC should be stored in Tris-based buffer with 50% glycerol at -20°C for extended storage, with working aliquots maintained at 4°C for up to one week to avoid repeated freeze-thaw cycles that may compromise activity .

What approaches can be used to identify novel YidC substrate proteins in B. pertussis?

Identifying novel YidC substrates in B. pertussis requires multi-faceted approaches:

  • Comparative Proteomics:

    • Quantitative proteomics comparing membrane proteome under YidC depletion versus normal expression

    • SILAC or TMT labeling for precise quantification

    • Analysis of membrane fraction enrichment/depletion patterns

    • Correlation with transcriptome data to distinguish direct from indirect effects

  • Proximity-based Identification:

    • BioID or APEX2 proximity labeling with YidC fusion proteins

    • Crosslinking mass spectrometry (XL-MS) with photo-activatable or chemical crosslinkers

    • Co-immunoprecipitation followed by mass spectrometry

    • Genetic interaction screening using transposon libraries

  • Bioinformatic Prediction:

    • Machine learning algorithms trained on known YidC substrates

    • Sequence motif identification in transmembrane segments

    • Topology prediction and charge distribution analysis

    • Evolutionary conservation patterns in potential interaction domains

  • Direct Binding Assays:

    • Surface plasmon resonance with immobilized YidC

    • Microscale thermophoresis with fluorescently labeled candidates

    • Reconstitution assays with purified candidate proteins

    • Bacterial two-hybrid screening with YidC bait constructs

These approaches should be applied with consideration for B. pertussis physiology, particularly examining proteins involved in virulence and host interaction that may utilize unique membrane insertion pathways.

What are the major technical challenges in studying B. pertussis YidC and how can they be overcome?

Researchers face several significant challenges when studying B. pertussis YidC:

  • Membrane Protein Solubility and Stability:

    • Challenge: YidC's hydrophobic nature complicates expression, purification, and handling.

    • Solutions: Employ specialized detergents (LMNG, GDN), fusion with solubility-enhancing tags (MBP, SUMO), and nanodiscs or SMALPs for detergent-free systems.

  • Functional Assay Development:

    • Challenge: Measuring YidC activity requires complex reconstitution systems.

    • Solutions: Develop simplified reporter assays using fluorescent substrate proteins, establish B. pertussis-specific complementation systems, and create high-throughput screening platforms.

  • B. pertussis Genetic Manipulation:

    • Challenge: Essential nature of YidC complicates genetic studies.

    • Solutions: Implement conditional depletion systems, CRISPR interference for partial knockdown, and dual-expression systems with mutant/wild-type proteins.

  • Structural Characterization:

    • Challenge: Obtaining high-resolution structures of dynamic membrane proteins.

    • Solutions: Utilize latest advances in cryo-EM for membrane proteins, develop conformationally stabilized constructs, and employ integrative structural biology combining multiple techniques.

  • Physiological Relevance:

    • Challenge: Connecting in vitro findings to in vivo function during infection.

    • Solutions: Develop cell culture infection models, employ tissue-engineered respiratory epithelium systems, and create animal models with humanized respiratory tissues.

These challenges mirror broader difficulties in membrane protein research but are compounded by B. pertussis-specific factors such as its fastidious growth requirements and complex virulence mechanisms.

How does YidC function integrate with other membrane protein biogenesis pathways in B. pertussis?

YidC functions within a complex network of membrane protein biogenesis pathways:

  • Interaction with Sec Translocon:

    • YidC likely cooperates with the SecYEG translocon in B. pertussis, facilitating lateral release of transmembrane segments into the lipid bilayer.

    • This cooperation may be substrate-specific, with some membrane proteins requiring both systems while others utilize YidC independently.

    • Research should examine whether B. pertussis YidC forms stable complexes with SecYEG or engages in more transient interactions.

  • Coordination with Chaperone Systems:

    • Cytoplasmic chaperones (likely including trigger factor and DnaK/DnaJ/GrpE) likely prevent aggregation of YidC substrates prior to membrane targeting.

    • Periplasmic chaperones may receive the extracellular domains of YidC substrates, facilitating their folding after membrane insertion.

    • The interplay between these chaperone networks and YidC remains poorly characterized in B. pertussis.

  • Integration with Signal Recognition Particle (SRP) Pathway:

    • The SRP pathway targets nascent membrane proteins to the membrane, potentially delivering some substrates to YidC.

    • B. pertussis likely utilizes this conserved pathway, but species-specific variations in efficiency or substrate recognition may exist.

  • Relationship to Twin-Arginine Translocation (Tat) System:

    • Some membrane proteins with periplasmic domains may utilize the Tat system for translocation while requiring YidC for transmembrane domain insertion.

    • The coordination between these systems in B. pertussis deserves investigation.

  • Quality Control Mechanisms:

    • Misfolded or improperly inserted membrane proteins likely trigger stress responses and degradation pathways.

    • How these quality control systems communicate with YidC in B. pertussis remains an open question.

Understanding these integrated pathways is crucial for comprehending membrane protein biogenesis in B. pertussis and may reveal unique vulnerabilities for therapeutic targeting.

What emerging technologies will advance our understanding of YidC function in B. pertussis?

Several cutting-edge technologies promise to transform our understanding of YidC function:

  • Cryo-Electron Tomography:

    • Visualization of YidC in its native membrane environment within intact B. pertussis cells

    • Mapping spatial relationships between YidC and other membrane protein biogenesis machinery

    • Capturing different functional states during active membrane protein insertion

  • Single-Molecule Techniques:

    • FRET-based approaches to monitor YidC conformational changes during substrate processing

    • Optical tweezers to measure forces involved in membrane protein insertion

    • Super-resolution microscopy to track YidC dynamics in living bacteria

  • Advanced Genetic Tools:

    • CRISPR-Cas systems adapted for precise B. pertussis genome editing

    • Inducible degron systems for rapid YidC depletion studies

    • Synthetic genetic interaction mapping to identify functional relationships

  • Microfluidic Systems:

    • Single-cell analysis of YidC function under controlled microenvironments

    • Real-time monitoring of membrane protein insertion in reconstituted systems

    • High-throughput screening platforms for YidC inhibitors

  • Artificial Intelligence Applications:

    • Machine learning algorithms for predicting YidC-substrate interactions

    • Structure prediction tools specifically trained on membrane protein datasets

    • Systems biology models integrating multi-omics data related to membrane protein biogenesis

  • Humanized Infection Models:

    • Organoid-based systems mimicking human respiratory epithelium

    • Microfluidic organ-on-chip devices for studying host-pathogen interactions

    • Ex vivo human tissue models for validating findings in physiologically relevant contexts

These technologies, applied individually or in combination, will provide unprecedented insights into YidC function and potentially reveal new approaches for therapeutic intervention against B. pertussis infections, which continue to pose public health challenges despite vaccination programs .

How does B. pertussis YidC compare with homologs in other respiratory pathogens?

B. pertussis YidC shares core functional features with homologs in other respiratory pathogens, but exhibits distinct characteristics that may reflect adaptation to its specific ecological niche:

The sequence conservation patterns observed across Bordetella species (with ~74-78% conservation for non-vaccine antigens between species) suggest that while YidC core functions are preserved, species-specific adaptations have occurred. These differences may influence substrate specificity, membrane insertion efficiency, and interactions with other cellular components, potentially contributing to pathogen-specific virulence mechanisms.

What insights can evolutionary analysis of YidC provide about B. pertussis adaptation?

Evolutionary analysis of YidC provides valuable insights into B. pertussis adaptation:

These evolutionary insights connect to broader patterns of genome evolution in B. pertussis, which has undergone significant genome reduction during adaptation to its human-restricted ecological niche.

How can comparative immunology approaches enhance vaccine development targeting membrane proteins like YidC?

Comparative immunology approaches offer promising strategies for vaccine development targeting membrane proteins:

  • T-cell Epitope Mapping:

    • Recent genome-wide studies have demonstrated that healthy adults develop T-cell responses to hundreds of different B. pertussis antigens beyond the conventional vaccine components

    • Similar approaches could identify immunogenic regions within YidC or other membrane proteins, particularly focusing on conserved domains that elicit strong T-cell responses

    • The discovery that non-vaccine antigens often lack Th1/Th2 polarization suggests they could potentially counteract the Th2 bias observed with current acellular pertussis vaccines

  • B-cell Epitope Identification:

    • Surface-exposed regions of membrane proteins that elicit protective antibody responses represent valuable vaccine candidates

    • Structural analysis of YidC can identify accessible epitopes, which can be verified through experimental epitope mapping

  • Cross-species Protection Assessment:

    • Conserved regions of YidC across Bordetella species could yield vaccines protective against multiple pathogens

    • This is particularly relevant given the significant disease burden caused by both B. pertussis and B. parapertussis

  • Novel Antigen Delivery Platforms:

    • Membrane proteins present challenges for vaccine formulation due to their hydrophobic nature

    • Approaches such as outer membrane vesicles, liposome-based delivery, or display on virus-like particles can enhance immunogenicity while maintaining native conformations

  • Combination Approaches:

    • Integration of membrane proteins like YidC with current acellular pertussis vaccine components could broaden immune responses

    • This strategy addresses the observation that the limited antigen repertoire of current acellular vaccines may contribute to their shorter duration of protection compared to whole-cell vaccines

These comparative approaches align with emerging findings that broader antigen recognition may be key to developing more effective pertussis vaccines with improved duration of protection.

What are the most effective protocols for analyzing YidC-dependent membrane protein insertion in B. pertussis?

Effectively analyzing YidC-dependent membrane protein insertion requires specialized protocols:

  • In Vivo Insertion Assays:

    • Protocol Design: Construct reporter proteins with domains requiring YidC insertion fused to enzymatic reporters (alkaline phosphatase, β-lactamase)

    • Implementation: Express under inducible promoters in YidC-depleted versus normal B. pertussis

    • Analysis: Measure reporter activity to quantify insertion efficiency; correct localization yields enzymatic activity

    • Controls: Include known YidC-dependent and YidC-independent substrates as reference points

  • In Vitro Reconstitution Assays:

    • System Components: Purified YidC in proteoliposomes, cell-free translation machinery, radiolabeled or fluorescently labeled substrate proteins

    • Procedure: Translate substrates in presence of YidC-proteoliposomes, monitor insertion through protease protection assays

    • Quantification: Compare band intensities of protected fragments by autoradiography or fluorescence imaging

    • Validation: Use YidC mutants with known defects to confirm specificity

  • Real-time Fluorescence-based Monitoring:

    • Reporter Design: Construct fusion proteins with environment-sensitive fluorophores that change emission properties upon membrane insertion

    • Implementation: Express in B. pertussis under conditions of normal or depleted YidC

    • Data Collection: Monitor fluorescence changes using flow cytometry or microscopy

    • Analysis: Calculate insertion kinetics and efficiency based on fluorescence transition rates

  • Pulse-Chase Analysis:

    • Experimental Design: Pulse-label bacteria with radiolabeled amino acids, chase with unlabeled medium

    • Fractionation: Separate cytoplasmic, membrane, and periplasmic fractions

    • Detection: Immunoprecipitate proteins of interest, analyze by SDS-PAGE and autoradiography

    • Quantification: Compare membrane integration kinetics in YidC-normal versus YidC-depleted conditions

How can researchers effectively use computational approaches to predict YidC-substrate interactions?

Computational approaches offer powerful tools for predicting YidC-substrate interactions:

  • Sequence-based Prediction Methods:

    • Hydrophobicity Analysis: Calculate transmembrane segment properties using scales optimized for YidC substrates

    • Charge Distribution Mapping: Analyze positive and negative charge clusters flanking transmembrane domains

    • Machine Learning Integration: Train algorithms on known YidC substrates, incorporating multiple sequence features

    • Implementation: Develop B. pertussis-specific scoring matrices based on confirmed substrates

  • Structural Modeling Approaches:

    • Homology Modeling: Generate B. pertussis YidC structural models based on available bacterial YidC structures

    • Molecular Docking: Simulate substrate peptide interactions with the YidC hydrophobic groove

    • Molecular Dynamics: Evaluate stability of predicted YidC-substrate complexes in membrane environments

    • Analysis: Identify key interaction residues and energetically favorable binding modes

  • Systems Biology Integration:

    • Correlation Networks: Analyze gene expression correlations between YidC and potential substrates

    • Protein-Protein Interaction Networks: Map known interaction partners to identify functional clusters

    • Evolutionary Coupling Analysis: Identify co-evolving residues between YidC and substrate proteins

    • Pathway Mapping: Integrate predictions with known membrane protein biogenesis pathways

  • Pipeline Development:

    • Multi-stage Filtering: Combine predictions from different algorithms to increase confidence

    • Scoring System: Develop weighted scores based on multiple parameters

    • Visualization Tools: Create interactive interfaces to explore predicted interactions

    • Experimental Validation Module: Design companion experimental protocols for top predictions

These computational approaches should be calibrated using the B. pertussis YidC amino acid sequence (563 residues) and validated against experimentally confirmed interactions before application to genome-wide substrate prediction.

What considerations are important when developing antibodies against B. pertussis YidC for research applications?

Developing effective antibodies against B. pertussis YidC requires addressing several key considerations:

  • Epitope Selection Strategy:

    • Accessibility Analysis: Prioritize regions predicted to be surface-exposed based on structural models

    • Specificity Assessment: Evaluate sequence uniqueness relative to other B. pertussis proteins and host proteins

    • Conservation Evaluation: For broad reactivity, target regions conserved across Bordetella species; for specificity, target variable regions

    • Recommended Targets: C-terminal region (amino acids 500-563) often yields good immunogenicity while maintaining specificity

  • Antibody Format Selection:

    • Polyclonal Development: Provides broad epitope recognition but potential batch variation

    • Monoclonal Production: Offers consistency and specificity but limited epitope coverage

    • Recombinant Antibody Fragments: Enables targeting of sterically restricted epitopes

    • Application-specific Considerations: Different formats may be optimal for Western blotting versus immunoprecipitation

  • Immunization Strategy Optimization:

    • Antigen Preparation: Use recombinant fragments, synthetic peptides, or full-length protein in detergent micelles

    • Adjuvant Selection: Choose adjuvants promoting strong antibody responses to membrane proteins

    • Immunization Schedule: Employ extended protocols to enhance affinity maturation

    • Host Selection: Consider species phylogenetically distant from humans for targeting conserved epitopes

  • Validation Requirements:

    • Specificity Testing: Confirm using YidC-depleted B. pertussis or heterologous expression systems

    • Cross-reactivity Assessment: Test against related Bordetella species if broad reactivity is desired

    • Application Testing: Validate for each intended use (Western blot, immunofluorescence, flow cytometry)

    • Epitope Mapping: Confirm binding to intended regions using peptide arrays or mutagenesis

  • Production and Storage Considerations:

    • Purification Strategy: Protein A/G for IgG, antigen-affinity for application-critical antibodies

    • Stabilization Approach: Add carriers for dilute solutions, glycerol for freeze protection

    • Storage Conditions: Aliquot to avoid freeze-thaw cycles, store at -20°C or -80°C for long-term

    • Quality Control: Test periodically for maintained activity and specificity

These considerations will help generate research-grade antibodies suitable for various applications in B. pertussis research, including studies of YidC localization, expression levels, and interactions with other cellular components.

What are the most promising future research directions for understanding YidC function in B. pertussis?

Future research on B. pertussis YidC should prioritize several promising directions:

  • Functional Genomics Approaches:

    • Comprehensive mapping of the YidC-dependent membranome through conditional depletion studies

    • CRISPR interference screens to identify synthetic lethal interactions with YidC

    • Transposon sequencing under YidC-limiting conditions to identify genetic interactions

  • Structural Biology Advances:

    • High-resolution structures of B. pertussis YidC in different functional states

    • Substrate-bound complexes revealing molecular details of membrane protein insertion

    • Conformational dynamics studies capturing the insertion mechanism

  • Host-Pathogen Interface:

    • Investigation of YidC's role in inserting virulence factors during infection

    • Examination of host immune recognition of YidC-dependent membrane proteins

    • Analysis of YidC function under host-imposed stress conditions

  • Therapeutic Targeting:

    • High-throughput screening for selective YidC inhibitors

    • Structure-guided design of inhibitory compounds

    • Development of YidC-dependent delivery systems for novel antimicrobials

  • Systems Biology Integration:

    • Multi-omics approaches correlating YidC activity with global cellular physiology

    • Mathematical modeling of membrane protein biogenesis networks

    • Temporal analysis of YidC function throughout the B. pertussis infection cycle

These research directions align with the broader need to understand membrane protein biogenesis in bacterial pathogens and could yield insights applicable beyond B. pertussis to other respiratory pathogens.

How might improved understanding of YidC contribute to addressing the resurgence of pertussis?

Enhanced understanding of YidC could contribute significantly to addressing pertussis resurgence through several mechanisms:

  • Vaccine Development Applications:

    • Identification of YidC-dependent membrane proteins as novel vaccine antigens

    • Development of vaccines targeting conserved membrane protein processing pathways

    • Contribution to next-generation pertussis vaccines that address the limitations of current acellular vaccines

  • Therapeutic Intervention Strategies:

    • Design of YidC inhibitors as novel antibiotics specific to Bordetella

    • Development of compounds that disrupt insertion of specific virulence factors

    • Creation of combination therapies targeting both membrane protein insertion and function

  • Diagnostic Improvement Opportunities:

    • Identification of YidC-dependent proteins as biomarkers for B. pertussis infection

    • Development of rapid tests based on membrane protein signatures

    • Integration with genomic surveillance approaches being developed for B. pertussis

  • Basic Understanding of Pathogenesis:

    • Clarification of how membrane protein biogenesis contributes to colonization

    • Insights into adaptation mechanisms following vaccination

    • Understanding of bacterial persistence in vaccinated populations

  • Public Health Implications:

    • Informing vaccine design to address waning immunity observed with acellular vaccines

    • Contributing to strategies for vulnerable population protection

    • Supporting development of intervention approaches targeting carrier states

The resurgence of pertussis despite widespread vaccination highlights the need for novel approaches , and targeting fundamental processes like membrane protein biogenesis represents a promising strategy that complements existing vaccination programs.

What interdisciplinary approaches will be most valuable for advancing B. pertussis YidC research?

Advancing B. pertussis YidC research will benefit most from integrative interdisciplinary approaches:

  • Structural Biology and Biophysics Integration:

    • Combining cryo-EM, NMR, and computational modeling to resolve dynamic aspects of YidC function

    • Applying single-molecule techniques to capture transient conformational states

    • Developing membrane mimetic systems that better reproduce the B. pertussis membrane environment

  • Immunology and Cell Biology Convergence:

    • Linking membrane protein biogenesis to immune recognition patterns

    • Examining how YidC-dependent proteins interact with host cell receptors

    • Investigating membrane protein presentation in the context of T-cell epitope recognition

  • Systems Biology and Computational Approaches:

    • Developing predictive models of membrane protein insertion networks

    • Integrating multi-omics data to map YidC's influence on cellular physiology

    • Applying machine learning to identify patterns in substrate recognition

  • Microbiology and Genomics Coordination:

    • Correlating genomic variations in yidC with phenotypic changes across clinical isolates

    • Applying culture-independent genomic approaches being developed for B. pertussis

    • Examining YidC evolution in the context of host adaptation

  • Medicinal Chemistry and Structural Biology Collaboration:

    • Structure-based design of YidC inhibitors

    • Fragment-based screening against defined YidC functional sites

    • Development of allosteric modulators of YidC function

  • Clinical Research and Basic Science Translation:

    • Examining YidC-dependent membrane proteome in clinical isolates

    • Correlating membrane protein profiles with disease severity and outcomes

    • Developing ex vivo infection models to validate laboratory findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.