nuoK is produced via recombinant DNA technology, typically expressed in E. coli with an N-terminal His-tag for purification. Key characteristics include:
The amino acid sequence of nuoK (UniProt ID: Q7VZP5) includes hydrophobic and transmembrane segments, consistent with its role in membrane-bound complexes .
nuoK serves as a research tool in microbiology, immunology, and vaccine development:
nuoK is explored as a potential antigen in subunit vaccines targeting Bordetella species. Recombinant proteins like nuoK offer safer alternatives to whole-cell vaccines, avoiding adverse effects .
Commercial ELISA kits (e.g., CSB-BP746327BUA) utilize recombinant nuoK for detecting anti-Bordetella antibodies, aiding in serological studies .
Proper storage and handling are critical for maintaining nuoK’s activity:
KEGG: bpe:BP0851
STRING: 257313.BP0851
Bordetella pertussis NADH-quinone oxidoreductase subunit K (nuoK) is a small membrane protein consisting of 102 amino acids with the sequence MTLTLAHYLILGAILFAIGIFGIFLNRRNLIILLMSIELVLLAVNMNFVAFSSWFGDIAGQVFVFFILTVAAAEAAIGLAILVLLFRNLNTINVDELDRLKG . It functions as a component of Complex I (NADH:ubiquinone oxidoreductase) in the respiratory chain. As a highly hydrophobic membrane protein, nuoK contains multiple transmembrane domains that anchor it within the bacterial inner membrane, where it contributes to proton translocation during electron transfer processes. This protein plays a critical role in energy metabolism of B. pertussis, contributing to the pathogen's ability to generate ATP through oxidative phosphorylation.
While much B. pertussis research focuses on virulence factors and immunogenic proteins like pertussis toxin and pertactin (P69) used in acellular vaccines , metabolic proteins such as nuoK provide valuable insights into pathogen survival mechanisms. Understanding respiratory chain components can reveal potential antimicrobial targets, especially as they are often conserved across bacterial species. Recent molecular epidemiology studies have demonstrated genomic diversity in circulating B. pertussis strains , suggesting potential variations in metabolic proteins like nuoK that could affect pathogen fitness. This protein represents an understudied aspect of B. pertussis biology that may contribute to our understanding of persistence and adaptation.
The E. coli expression system has been successfully used to produce recombinant nuoK protein with an N-terminal His-tag . For membrane proteins like nuoK, several considerations are critical:
Expression strain selection: C41(DE3) or C43(DE3) E. coli strains often yield better results for membrane proteins than standard BL21(DE3).
Induction conditions: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) typically improve folding of membrane proteins.
Membrane fraction isolation: Careful cell lysis followed by ultracentrifugation to separate membrane fractions.
Detergent selection: For membrane proteins like nuoK, detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are often effective for solubilization.
While E. coli remains the predominant expression system, yeast expression platforms like Pichia pastoris have shown success with other B. pertussis proteins, yielding up to 3 g/L for proteins like pertactin , suggesting this could be an alternative for nuoK expression if higher yields are required.
Purifying membrane proteins like nuoK requires specialized approaches:
Affinity chromatography: Utilize the His-tag with immobilized metal affinity chromatography (IMAC) under conditions that maintain protein solubility in detergent micelles.
Buffer optimization: Include appropriate detergent concentrations (typically above CMC) in all buffers.
Two-step purification protocol:
Initial IMAC capture in presence of high detergent concentration
Size exclusion chromatography to remove aggregates and achieve >95% purity
Typical purification yields reported for similar membrane proteins range from 1-5 mg/L of culture, with final purity greater than 90% as assessed by SDS-PAGE . During reconstitution, adding 5-50% glycerol to the storage buffer is recommended to maintain protein stability during freeze-thaw cycles .
Traditional X-ray crystallography presents challenges for small membrane proteins like nuoK. Alternative approaches include:
Cryo-electron microscopy (cryo-EM): Most effective when studying nuoK as part of the larger Complex I structure rather than in isolation.
NMR spectroscopy: Solution NMR with detergent-solubilized protein or solid-state NMR with reconstituted proteoliposomes.
Molecular dynamics simulations: Computational approaches to predict structure and membrane interactions.
Site-directed mutagenesis: Systematic mutation of conserved residues coupled with functional assays.
Crosslinking studies: To identify interaction partners within Complex I.
Each method has specific sample preparation requirements. For instance, NMR studies typically require isotope labeling (15N, 13C) during expression, while cryo-EM approaches benefit from stabilized protein complexes, potentially using nanodiscs or amphipols as alternatives to detergent micelles.
Functional characterization of nuoK involves:
For comparison studies, the following table outlines typical experimental parameters:
| Experimental Approach | Measurable Parameters | Technical Considerations |
|---|---|---|
| Proteoliposome assays | Proton translocation, membrane potential | Requires careful control of lipid composition |
| Whole-cell respiration | Oxygen consumption, NADH oxidation | Cannot isolate nuoK-specific effects |
| Mutant complementation | Growth rates, ATP production | Requires nuoK knockout strain |
| Site-directed mutagenesis | Structure-function relationships | Specific residues must be carefully selected |
Laboratory diagnosis of B. pertussis currently relies primarily on culture, PCR, and immunological assays . The potential applications of nuoK in diagnostics include:
PCR targets: While IS481 is the most common PCR target for B. pertussis detection, multi-target approaches could incorporate conserved regions of nuoK for increased specificity.
Serological markers: Antibodies against nuoK could potentially serve as markers of recent infection, though this requires validation.
MALDI-TOF MS identification: Protein profiles including nuoK signatures could enhance bacterial identification when combined with genomic approaches.
Current PCR diagnostics for B. pertussis show sensitivity limitations, with multi-target PCRs demonstrating only 56-67% positivity rates compared to single target specific PCRs among clinically confirmed cases . Adding highly conserved metabolic genes like nuoK to diagnostic panels could potentially improve detection, though validation studies would be needed.
While current acellular pertussis vaccines focus on virulence factors like pertussis toxoid and can be enhanced by the addition of other antigens like pertactin , metabolic proteins like nuoK offer different research avenues:
Novel vaccine target exploration: Conserved proteins like nuoK could potentially provide broader protection against diverse strains.
Adjuvant research: Recombinant nuoK could be studied for immunomodulatory properties when combined with existing vaccine antigens.
Biomarker development: Expression patterns of nuoK during infection might serve as indicators of bacterial metabolic state, informing vaccine design.
The recombinant expression capabilities demonstrated for other B. pertussis antigens, such as pertactin yield of >3 g/L in P. pastoris , suggest that sufficient quantities of nuoK could be produced for research applications, though its membrane protein nature presents additional challenges.
Molecular epidemiology studies have revealed genomic diversity in B. pertussis populations, with multiple MLVA (Multi-Locus Variable Number of Tandem Repeat Analysis) types identified . To investigate nuoK variation:
Comparative genomics approach: Analyze nuoK sequences across clinical isolates, particularly focusing on MT6 and MT4 strains that have been associated with recent outbreaks .
Fitness assessment methods:
Growth curve analysis in varied environmental conditions
Competition assays between strains with different nuoK variants
Measurement of respiratory efficiency using oxygen consumption rates
Assessment of antibiotic tolerance profiles
Evidence for significant genomic variation in B. pertussis populations suggests potential for metabolic adaptations that could involve respiratory chain components like nuoK. The recent outbreaks of MT6 (65.0%) and MT4 (26.7%) strains provide an opportunity to correlate nuoK sequence variations with clinical and epidemiological patterns.
Disentangling the specific contributions of nuoK requires sophisticated approaches:
Gene knockout complementation studies: Create nuoK deletion mutants and complement with variants to assess specific functions.
Protein-protein interaction mapping: Techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking mass spectrometry to identify interaction partners.
In vivo expression profiling: Transcriptomics and proteomics of bacteria isolated from different infection stages.
Inhibitor studies: Utilizing specific respiratory chain inhibitors to dissect the contribution of different components.
Methodology considerations include:
Cell culture infection models to simulate host-pathogen interactions
Animal models for in vivo relevance
Patient sample analysis for clinical correlation
| Challenge | Potential Solutions | Success Indicators |
|---|---|---|
| Low expression yields | Optimize codon usage; try fusion partners; test different E. coli strains; reduce induction temperature | >1 mg/L culture yield; visible band on SDS-PAGE |
| Inclusion body formation | Express at lower temperatures (16°C); reduce inducer concentration; use solubility-enhancing tags | Increased protein in soluble/membrane fraction |
| Protein aggregation during purification | Optimize detergent type and concentration; include glycerol or stabilizing agents | Monodisperse peak on size exclusion chromatography |
| Loss of activity | Reconstitute in lipid bilayers; maintain reducing environment; avoid freeze-thaw cycles | Retained electron transport activity in functional assays |
| Difficulty in structural analysis | Try multiple membrane mimetics (nanodiscs, amphipols); co-purify with interaction partners | Homogeneous sample by negative stain EM |
For recombinant nuoK specifically, research protocols suggest storing at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles . Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with addition of 5-50% glycerol (final concentration) is recommended for long-term storage .