Recombinant Bordetella pertussis Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bordetella pertussis Protein CrcB Homolog (crcB)

The Recombinant Bordetella pertussis Protein CrcB homolog (crcB) is a genetically engineered version of the crcB protein, a member of the calcium:cation antiporter superfamily. This protein is implicated in manganese transport and stress adaptation in B. pertussis, the causative agent of whooping cough. Recombinant production enables its study for vaccine development and bacterial pathogenesis research .

Functional Role in B. pertussis Physiology

  • Manganese Homeostasis:

    • Inactivation of crcB due to the duplication leads to cytosolic manganese accumulation, enhancing bacterial survival under oxidative stress .

    • Under manganese toxicity, "resister" strains excise the duplication, restoring exporter function but reducing intracellular manganese levels and growth efficiency .

  • Adaptive Mechanism: The duplication is conserved in 98% of B. pertussis strains, suggesting evolutionary selection for stress adaptation in human hosts .

Recombinant Production and Purification

  • Expression Systems: Optimized in E. coli for high yield (>90% purity) . Alternative systems (yeast, mammalian cells) are available but less commonly used .

  • Applications:

    • Vaccine development: Investigated as a component for acellular pertussis vaccines due to its immunogenic potential .

    • Structural studies: Used to analyze metal transport mechanisms in pathogenic bacteria .

5.1. Manganese Toxicity and Adaptation

  • Wild-type B. pertussis with nonfunctional crcB survives high manganese concentrations by retaining cytosolic manganese, which acts as an antioxidant .

  • Resister strains (with functional crcB) show impaired growth under oxidative stress due to reduced manganese levels .

5.2. Immunogenicity and Vaccine Potential

Comparative Analysis with Homologs

OrganismProteinKey Differences
B. pertussiscrcBNonfunctional duplication; manganese accumulation strategy
Shewanella pealeanacrcB homologFull-length functional exporter; used for structural modeling
Methanocaldococcus jannaschiiAntiporter homologLacks duplication; serves as a functional template for crcB studies

Challenges and Future Directions

  • Functional Studies: Mechanistic details of crcB’s role in B. pertussis virulence remain understudied.

  • Vaccine Integration: Requires validation in animal models to assess protective efficacy alongside pertussis toxoid and pertactin .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. This can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
crcB; BP1217; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Target Names
crcB
Target Protein Sequence
MLTYAPLNFIAIGIGATLGAWLRWVLGLRLNGAGWPWGTLTANLVGGYLIGVMVALIASH PEWPAWIRLAAVTGFLGGLTTFSTFSAETVDMLERGVYATAAAYAGASLAGSLAMTGLGL ATVRLLLR
Uniprot No.

Target Background

Function
Crucial for reducing fluoride concentration within cells, thereby minimizing its toxicity.
Database Links

KEGG: bpe:BP1217

STRING: 257313.BP1217

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of CrcB homolog in Bordetella pertussis?

The CrcB homolog in B. pertussis is primarily involved in fluoride ion channel activity and resistance mechanisms. While specific research on B. pertussis CrcB is limited, comparative genomic studies indicate it shares structural similarities with CrcB proteins in other bacteria that function as fluoride ion channels to protect cellular processes from fluoride toxicity. Like other membrane proteins in B. pertussis, CrcB likely plays a role in maintaining bacterial homeostasis during environmental stress conditions. The protein may contribute to bacterial survival in host environments, particularly in the respiratory tract where B. pertussis typically establishes infection .

What is known about the structural characteristics of B. pertussis CrcB homolog?

The B. pertussis CrcB homolog is predicted to be a membrane protein with multiple transmembrane domains that form ion channel structures. Based on homology to other bacterial CrcB proteins, it likely forms dimers that create a fluoride-selective ion channel. Structural predictions suggest the protein contains highly conserved regions essential for ion selectivity and channel function. Genome-scale metabolic modeling approaches, similar to those used for other B. pertussis proteins, can help predict structural features and functional domains of CrcB . Further structural studies using X-ray crystallography or cryo-electron microscopy would be necessary to confirm these predictions.

What expression systems are most effective for producing recombinant B. pertussis CrcB homolog?

For recombinant expression of B. pertussis CrcB homolog, several expression systems have shown promise based on experience with other B. pertussis membrane proteins:

  • E. coli expression systems: Modified strains like C41(DE3) or C43(DE3) designed for membrane protein expression show higher success rates for challenging membrane proteins like CrcB.

  • Streptococcus gordonii expression system: This has been successfully used for other B. pertussis proteins, as demonstrated with PT-FHA fusion proteins . This commensal oral bacterium can secrete properly folded recombinant proteins into culture medium.

  • B. pertussis native expression: Using modified B. pertussis strains may yield protein with native conformation and post-translational modifications.

When designing expression vectors, consider including:

  • Affinity tags (His6, GST) positioned to minimize interference with protein function

  • Protease cleavage sites for tag removal

  • Codon optimization for the expression host

  • Inducible promoters to control expression levels

Expression yields for membrane proteins like CrcB are typically lower than for soluble proteins, requiring optimization of induction conditions (temperature, inducer concentration, induction time) .

What purification strategies yield high-purity recombinant CrcB protein?

Purification of recombinant B. pertussis CrcB homolog requires specialized approaches for membrane proteins:

Purification StepMethodConsiderations
Membrane extractionDetergent solubilizationTest multiple detergents (DDM, LDAO, FC-12)
Initial captureAffinity chromatographyIMAC for His-tagged proteins
Intermediate purificationIon exchange chromatographyBased on predicted pI of CrcB
PolishingSize exclusion chromatographyAssesses protein homogeneity
Quality controlSDS-PAGE, Western blottingVerify purity and identity

Successful purification of B. pertussis proteins has been achieved using combined approaches of affinity and gel permeation chromatography, as demonstrated with PT-FHA fusion proteins . The critical step is optimizing detergent concentration to maintain protein stability while removing excess detergent that can interfere with downstream applications. Purification under native conditions is preferred to preserve protein conformation and activity .

How can I verify the proper folding and function of recombinant CrcB?

Verification of proper folding and function for recombinant CrcB homolog should include multiple complementary approaches:

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure content

    • Fluorescence spectroscopy to assess tertiary structure

    • Size exclusion chromatography to verify oligomeric state

  • Functional assays:

    • Fluoride ion transport assays using proteoliposomes

    • Electrophysiology methods for ion channel characterization

    • Fluoride resistance complementation in CrcB-deficient bacterial strains

  • Binding studies:

    • Surface plasmon resonance (SPR) to measure interaction with ligands

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

The recombinant protein should be tested for recognition by specific antibodies, similar to methods used for other B. pertussis proteins like the AfuA homolog, where recognition by specific antibodies confirmed proper protein conformation .

How can recombinant CrcB be utilized in vaccine development against B. pertussis?

While recombinant CrcB is not currently a component of acellular pertussis vaccines, its potential as a vaccine candidate could be evaluated following approaches used for other B. pertussis proteins:

  • Immunogenicity assessment:

    • Evaluate antibody responses in mouse models following both parenteral and mucosal immunization

    • Test for production of specific antibodies recognizing native CrcB on B. pertussis surface

    • Assess cross-reactivity with B. parapertussis CrcB homolog

  • Protection studies:

    • Challenge immunized mice with B. pertussis to evaluate protection

    • Measure bacterial clearance rates from respiratory tract

    • Assess opsonization capacity of anti-CrcB antibodies

  • Combination approaches:

    • Test CrcB in combination with established vaccine antigens (PT, FHA, PRN)

    • Consider fusion protein approaches as demonstrated with PT-FHA fusion proteins

    • Evaluate adjuvant combinations for optimal immune responses

Current acellular pertussis vaccines contain proteins such as PT, FHA, PRN, and Fim2/3, but additional protective antigens may improve vaccine efficacy against both B. pertussis and B. parapertussis . If CrcB proves to be surface-exposed and immunogenic, it could potentially be evaluated as a novel component in next-generation vaccines.

What techniques can be used to study CrcB's role in B. pertussis metabolism?

To investigate CrcB's role in B. pertussis metabolism, several complementary approaches can be employed:

  • Genome-scale metabolic modeling:

    • Integrate CrcB into existing curated genome-scale metabolic models of B. pertussis

    • Perform flux balance analysis to predict metabolic impacts of CrcB activity

    • Simulate CrcB knockout effects on growth and metabolism

  • Multi-omics approaches:

    • Transcriptomics to measure gene expression changes in CrcB mutants

    • Proteomics to assess protein-level changes in response to CrcB manipulation

    • Metabolomics to identify metabolic pathways affected by CrcB activity

  • Growth phenotyping:

    • Culture CrcB mutants under various nutrient and stress conditions

    • Monitor growth rates, biomass yields, and metabolite consumption/production

    • Test fluoride sensitivity under different metabolic states

The longitudinal multi-omics analysis approaches demonstrated for B. pertussis cultures would be particularly valuable for understanding CrcB's role during different growth phases and under various environmental conditions . Such analyses could reveal how CrcB expression correlates with metabolic changes and stress responses during bacterial growth.

How does CrcB expression change during different growth phases of B. pertussis?

CrcB expression in B. pertussis likely follows complex regulation patterns throughout bacterial growth:

  • Early exponential phase:
    Expression may be relatively low as the bacteria adapt to culture conditions. Similar to patterns observed in other B. pertussis genes during early growth (1-4 hours), CrcB expression likely establishes baseline levels during this adaptation period .

  • Mid-exponential phase:
    CrcB expression might increase in response to metabolic demands and accumulating stress factors. Multi-omics studies of B. pertussis have shown significant transcriptional and protein-level changes during exponential growth (8-12 hours), particularly in response to nutrient limitations such as cysteine and proline starvation .

  • Late exponential/stationary phase:
    Expression patterns may shift as bacteria enter nutrient limitation and increased stress conditions (18-26 hours). During this period, B. pertussis shows major molecular changes, including a transition to internal nutrient stock consumption .

Monitoring CrcB expression through a time-course experiment using quantitative PCR, western blotting, or proteomics approaches would provide insights into its regulation throughout the bacterial growth cycle, similar to the longitudinal multi-omics analysis conducted for other B. pertussis proteins .

How can I troubleshoot low expression yields of recombinant CrcB protein?

Low expression yields of recombinant B. pertussis CrcB homolog can be systematically addressed through these approaches:

  • Expression system optimization:

    • Test alternative expression hosts (E. coli C41/C43 strains, S. gordonii, B. pertussis)

    • Optimize codon usage for the expression host

    • Try different promoter systems (T7, tac, araBAD)

    • Vary expression temperatures (16°C, 25°C, 30°C)

  • Protein toxicity mitigation:

    • Use tight expression control with glucose repression

    • Test fusion partners that enhance solubility (MBP, SUMO, Trx)

    • Express as inclusion bodies followed by refolding

    • Use strains with additional copies of rare tRNAs

  • Culture condition optimization:

    • Test rich vs. minimal media formulations

    • Optimize inducer concentration and timing

    • Supplement with ion cofactors if needed

    • Consider auto-induction media

For B. pertussis proteins, cultivation conditions significantly impact protein expression. Carefully monitor growth parameters (pH, temperature, dissolved oxygen) as demonstrated in small-scale bioreactor cultures of B. pertussis . Additionally, check for protein toxicity to host cells and consider using specialized strains designed for membrane protein expression.

What controls are essential when studying CrcB localization in B. pertussis?

When investigating CrcB localization in B. pertussis, these controls are essential:

  • Antibody specificity controls:

    • Pre-immune serum or isotype controls for immunostaining

    • Peptide competition assays to confirm antibody specificity

    • CrcB knockout strain as negative control

    • Recombinant CrcB protein as positive control

  • Subcellular fractionation controls:

    • Verify fraction purity using markers for each cellular compartment:

      • Cytoplasm: Cytoplasmic enzyme control (e.g., GroEL)

      • Inner membrane: Known inner membrane protein control

      • Outer membrane: Known outer membrane protein control

    • Include protease protection assays to distinguish surface exposure

  • Microscopy controls:

    • Include known localization markers for co-localization studies

    • Use multiple labeling methods (antibody, GFP fusion)

    • Perform z-stack imaging to confirm membrane localization

    • Include non-permeabilized and permeabilized samples

Experimental designs should follow approaches similar to those used for other B. pertussis surface antigens like AfuA, where surface exposure was confirmed and antibody recognition was verified even in the presence of potentially shielding O-antigen .

How can I validate CrcB knockout or knockdown models in B. pertussis?

Validation of CrcB knockout or knockdown models in B. pertussis requires comprehensive verification:

  • Genetic verification:

    • PCR confirmation of gene deletion or disruption

    • Whole genome sequencing to confirm absence of compensatory mutations

    • RT-qPCR to verify absence of transcript expression

    • Northern blotting to confirm absence of alternative transcripts

  • Protein-level verification:

    • Western blotting to confirm absence of CrcB protein

    • Proteomics to assess impacts on other proteins

    • Complementation with wild-type CrcB to restore phenotype

    • Heterologous expression of B. pertussis CrcB in other bacterial species

  • Phenotypic characterization:

    • Growth curve analysis under various conditions

    • Fluoride sensitivity testing

    • Metabolic profiling comparison to wild-type

    • In vitro and in vivo infection models to assess virulence effects

For rigorous validation, consider using transposon-directed insertional sequencing (TraDIS) approaches similar to those used to test genome-wide screens for essential genes in B. pertussis . This would help determine if CrcB is essential under specific growth conditions and provide insights into its functional importance.

What approaches can resolve contradictory findings about CrcB function?

When facing contradictory findings about B. pertussis CrcB function, consider these systematic approaches:

  • Methodological reconciliation:

    • Compare experimental conditions across studies (media, growth phase, strain differences)

    • Standardize protocols for protein expression and purification

    • Use multiple complementary techniques to assess the same function

    • Replicate key experiments in multiple laboratories

  • Strain and genetic context assessment:

    • Verify genetic background of strains used (lab adaptations, mutations)

    • Consider strain-specific regulatory differences

    • Examine impact of expression tags on protein function

    • Test CrcB function in heterologous systems

  • Environmental and physiological context:

    • Evaluate CrcB function under different stress conditions

    • Test function at different growth phases

    • Consider impact of nutrient availability on CrcB activity

    • Assess temperature and pH effects on protein function

  • Integrated analysis:

    • Apply multi-omics approaches (transcriptomics, proteomics, metabolomics)

    • Develop computational models integrating contradictory data

    • Use systems biology approaches to predict contextual function

The longitudinal multi-omics approach demonstrated for B. pertussis cultures would be particularly valuable for resolving contradictions, as it can reveal how protein function changes across different conditions and growth phases . This comprehensive approach could help identify the specific contexts in which particular CrcB functions are dominant.

What role might CrcB play in B. pertussis adaptation to environmental stresses?

CrcB may serve as an important component in B. pertussis stress response systems, particularly in relation to ion homeostasis. Future research should investigate:

  • Stress response regulation:

    • Determine if CrcB expression is upregulated during specific stress conditions

    • Identify transcriptional regulators controlling CrcB expression

    • Map CrcB's position in stress response networks

    • Evaluate role in adaptation to host environment

  • Ion homeostasis mechanisms:

    • Characterize CrcB's role in fluoride resistance in comparison to other pathogens

    • Investigate potential secondary roles in other ion transport processes

    • Examine interactions with other ion transport systems

    • Measure ion flux in CrcB mutants under stress conditions

  • Metabolic adaptation:

    • Assess how CrcB activity affects central metabolism during stress

    • Investigate connections to observed cysteine and proline starvation responses

    • Determine if CrcB contributes to internal stock consumption during nutrient limitation

    • Examine potential impacts on growth rate and biomass yield under stress

Understanding CrcB's role in stress adaptation could have significant implications for vaccine manufacturing processes, potentially leading to improved growth conditions and higher biomass yields, addressing challenges currently observed in B. pertussis cultures .

How can structural studies of CrcB inform drug design targeting B. pertussis?

Structural characterization of B. pertussis CrcB could enable rational drug design approaches:

  • Structure determination strategies:

    • X-ray crystallography of purified recombinant CrcB

    • Cryo-electron microscopy for membrane-embedded CrcB

    • NMR studies of CrcB domains

    • Computational modeling based on homologous proteins

  • Drug targeting opportunities:

    • Identify unique structural features in B. pertussis CrcB

    • Map the ion channel pore and gating mechanism

    • Locate potential allosteric regulation sites

    • Design small molecules to block channel function

  • Structure-based screening approaches:

    • Virtual screening against CrcB structural models

    • Fragment-based drug discovery targeting CrcB binding pockets

    • Peptidomimetic design based on protein-protein interaction surfaces

    • Validation of hits using functional assays

If CrcB proves essential for B. pertussis survival or virulence, structural studies could inform the development of novel therapeutic approaches. Additionally, understanding structural features shared with CrcB homologs in other pathogens might enable development of broad-spectrum antimicrobials targeting this protein family.

The genome-scale metabolic modeling approaches used for B. pertussis could incorporate structural information about CrcB to predict its impact on cellular metabolism under different conditions, further informing drug development strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.