Recombinant Bordetella pertussis Sulfoxide reductase heme-binding subunit YedZ (yedZ)

How does YedZ function within the bacterial physiology of B. pertussis?

YedZ functions as a heme-binding component of the sulfoxide reductase system in B. pertussis, participating in redox reactions that may contribute to bacterial adaptation to environmental stresses. Similar to other membrane-bound heme proteins, YedZ likely plays a role in electron transfer processes across the bacterial membrane. In B. pertussis, this function may be particularly important during infection, as the bacterium must navigate the oxidative environment of the respiratory tract . The protein's function is interconnected with the bacterium's virulence mechanisms, which include toxins like pertussis toxin (PTX) that modulate host immune responses to aid invasion and immune evasion . The expression of YedZ may be regulated under specific environmental conditions that mimic host infection, such as temperatures above 37°C, similar to the activation patterns observed for other virulence factors in B. pertussis .

What expression systems are recommended for recombinant production of YedZ?

For the recombinant production of YedZ, Escherichia coli (E. coli) expression systems are commonly employed due to their versatility and high yield potential. Based on experimental design approaches in recombinant protein expression:

• Expression vector selection: Vectors containing strong inducible promoters (such as T7) with appropriate affinity tags facilitate controlled expression and subsequent purification.

• Host strain considerations: BL21(DE3) or its derivatives are preferred for membrane proteins like YedZ due to their reduced protease activity and compatibility with T7 expression systems.

• Induction conditions optimization: Temperature, inducer concentration, and induction duration significantly impact soluble protein yield. Experimental design methodologies, as demonstrated for other recombinant proteins, have achieved high levels (250 mg/L) of soluble expression by optimizing these parameters .

• Membrane protein-specific adaptations: Lower induction temperatures (16-25°C) and reduced inducer concentrations often improve proper folding of membrane proteins like YedZ.

The optimization of these conditions through systematic experimental design approaches can significantly improve yield and functionality of the recombinant protein .

How can experimental design approaches optimize YedZ expression and purification?

The optimization of YedZ expression and purification can be systematically approached using experimental design methodologies (DoE) to maximize yield and functionality:

• Factorial design implementation: A multifactorial experimental design approach allows for simultaneous evaluation of key variables affecting protein expression, including:

  • Temperature (post-induction)

  • Inducer concentration

  • Duration of expression

  • Media composition

  • Cell density at induction

• Response surface methodology (RSM): After identifying significant variables through factorial screening, RSM can be used to determine optimal conditions for YedZ expression. This approach has been shown to effectively optimize recombinant protein expression with fewer experiments and minimal resources .

• Purification strategy optimization:

  • Detergent screening for membrane protein solubilization

  • Chromatography sequence determination

  • Buffer composition optimization

• Statistical validation: The implementation of statistical tools for validating experimental results enhances reproducibility and reliability of the optimized protocol.

Table 1: Example Design of Experiment Matrix for YedZ Expression Optimization

Using this DoE approach can significantly reduce the number of experiments needed while systematically identifying optimal conditions for soluble, functional YedZ expression .

What are the challenges in maintaining YedZ stability and functionality during purification?

Maintaining YedZ stability and functionality during purification presents several challenges due to its nature as a membrane-associated heme-binding protein:

• Heme retention: The heme cofactor is essential for YedZ functionality. Purification conditions must preserve the heme-protein interaction, which can be monitored spectrophotometrically during the purification process.

• Membrane protein solubilization: Selection of appropriate detergents is critical. A systematic detergent screening approach should evaluate:

  • Mild detergents (DDM, LMNG)

  • Solubilization efficiency

  • Protein stability

  • Activity preservation

• Buffer optimization: Storage buffer composition significantly impacts protein stability. For YedZ, a Tris-based buffer with 50% glycerol has been demonstrated to be effective for storage .

• Storage considerations:

  • Store at -20°C for short-term use

  • For extended storage, conserve at -20°C or -80°C

  • Avoid repeated freezing and thawing

  • Working aliquots can be maintained at 4°C for up to one week

• Functionality assessment: Regular monitoring of heme binding and enzymatic activity throughout the purification process ensures that the isolated protein maintains its native properties.

Addressing these challenges requires a systematic approach to buffer and detergent optimization, along with careful monitoring of protein quality at each purification step.

How does YedZ interact with other components of the bacterial electron transport system?

The interaction of YedZ with other components of the bacterial electron transport system involves:

• Protein-protein interaction studies: Techniques such as pull-down assays, bacterial two-hybrid systems, and co-immunoprecipitation can identify interaction partners within the electron transport chain.

• Membrane complex analysis: Blue native PAGE combined with mass spectrometry can resolve the membrane complexes containing YedZ and identify associated proteins.

• Electron transfer mechanism: Electrochemical techniques and stopped-flow kinetics can elucidate:

  • Redox potential of the heme center

  • Electron transfer rates

  • Interaction with electron donors and acceptors

• Structural basis of interactions: Molecular modeling based on the amino acid sequence (MPAAPLTARAIGRIKPLLFVAGLLPFARWFWLGANDGLSANPVEFLTRSSGTWTLVCLLVTLAITPLRRLTGQPALVRLRRMCGLFAFFYGSLHFLAWVWWDRGLDPVSMLQDVGERPFITVGFAAFVLMAALAATSTQWAMRKLGKRWQTLHRAVYAIGLLAILHFWWHKAGKNDLQQPLLYGSVLALLLGWRVAAWWRRRGAAR) reveals transmembrane domains that likely position the heme group for optimal electron transfer.

• Functional conservation: Comparative analysis with homologous proteins in other bacteria can provide insights into conserved interaction mechanisms across species.

Understanding these interactions is crucial for elucidating the role of YedZ in B. pertussis metabolism and potentially identifying new targets for therapeutic intervention in whooping cough infections.

How can the Experimental Design Assistant (EDA) improve YedZ research quality?

The Experimental Design Assistant (EDA) can significantly enhance the quality and reproducibility of YedZ research through:

• Structured experimental planning: The EDA provides a computer-aided design tool to develop a diagrammatic representation of the experimental plan for YedZ studies, ensuring logical flow and comprehensive consideration of variables .

• Expert feedback system: The system's critique functionality delivers tailored feedback on experimental plans, helping researchers identify potential confounding variables specific to membrane protein studies such as YedZ .

• Randomization and blinding support: The EDA generates appropriate randomization sequences and supports allocation concealment and blinding, which are critical for unbiased assessment of YedZ function or expression optimization .

• Statistical analysis guidance: The system suggests appropriate statistical methods for analyzing YedZ expression or functional data, helping researchers avoid common pitfalls in data interpretation .

• Sample size calculation: Proper sample size determination ensures sufficient statistical power to detect meaningful effects in YedZ studies, reducing waste of resources and improving reliability .

Table 2: EDA Features Applicable to YedZ Research

Implementing the EDA in YedZ research promotes better understanding of experimental design principles and raises awareness about potential issues caused by inadequate randomization, blinding, or statistical analysis .

What are the critical variables to control when studying YedZ function in vitro?

When studying YedZ function in vitro, several critical variables must be carefully controlled to ensure reproducible and valid results:

• Buffer composition:

  • pH maintenance (typically pH 7.0-8.0)

  • Ionic strength

  • Presence of stabilizing agents

  • Detergent concentration (for membrane-associated YedZ)

• Redox environment:

  • Oxygen concentration

  • Presence of reducing agents

  • Redox potential of the solution

• Heme cofactor integrity:

  • Monitoring spectroscopic properties

  • Prevention of oxidative damage

  • Maintaining the native coordination state

• Temperature control:

  • Assay temperature (optimally 37°C, mimicking host conditions)

  • Temperature stability during measurements

  • Impact of temperature on protein-substrate interactions

• Substrate considerations:

  • Purity and stability

  • Concentration ranges (determining Km values)

  • Potential inhibitory effects at high concentrations

• Nuisance variables:

  • Day-to-day variation

  • Equipment calibration

  • Reagent batch effects

These variables can be systematically controlled and documented using the Experimental Design Assistant (EDA) framework, which helps to identify potential confounding factors and incorporate them into the experimental design as covariates or blocking factors .

How can researchers assess the impact of mutations on YedZ structure and function?

Researchers can systematically assess the impact of mutations on YedZ structure and function through:

• Site-directed mutagenesis strategy:

  • Targeting conserved residues based on sequence alignment

  • Focusing on predicted heme-binding residues

  • Altering transmembrane domains

  • Modifying potential substrate interaction sites

• Expression and purification of mutants:

  • Comparing expression levels with wild-type YedZ

  • Assessing protein stability and folding

  • Evaluating heme incorporation efficiency

• Structural characterization:

  • Circular dichroism spectroscopy for secondary structure analysis

  • UV-visible spectroscopy for heme environment assessment

  • Limited proteolysis to probe structural integrity

  • Thermal stability measurements

• Functional assays:

  • Electron transfer rate measurements

  • Substrate binding affinity determination

  • Enzyme kinetics (kcat, Km) comparison

  • Redox potential measurements

• In silico analysis:

  • Molecular dynamics simulations

  • Structural modeling

  • Electrostatic surface calculation

  • Prediction of mutation effects on protein stability

• Statistical analysis of results:

  • ANOVA to compare multiple mutants

  • Post-hoc tests for pairwise comparisons

  • Correlation analysis between structural and functional parameters

By combining these approaches, researchers can develop a comprehensive understanding of structure-function relationships in YedZ and identify critical residues for catalytic activity, heme binding, and membrane integration.

How does YedZ contribute to B. pertussis virulence and pathogenesis?

The role of YedZ in B. pertussis virulence and pathogenesis can be assessed by examining its potential contributions to:

• Oxidative stress resistance: As a sulfoxide reductase component, YedZ likely participates in defense against host-generated reactive oxygen species, which is critical for B. pertussis survival in the respiratory tract.

• Metabolic adaptation: YedZ may enable metabolic flexibility during infection by participating in alternative electron transport pathways, especially under the microaerobic conditions encountered in the respiratory mucosa.

• Coordination with virulence factors: YedZ function may be coordinated with known virulence factors such as pertussis toxin (PTX), which modulates host immune responses to aid invasion and immune evasion . The expression and activity patterns may follow similar regulation as PTX, which is activated by conditions mimicking host infection (temperatures above 37°C and specific ionic environments) .

• Contribution to persistence: The redox functions of YedZ could support bacterial persistence during chronic infection phases by maintaining cellular redox balance under stress conditions.

• Host interaction: YedZ may participate in sensing host environmental cues that trigger virulence gene expression, similar to other sensor systems in pathogenic bacteria.

Understanding these aspects requires integration of YedZ research with broader studies on B. pertussis evolution in response to vaccination and changing host immunity patterns .

What role might YedZ play in B. pertussis adaptation to vaccine-induced immunity?

YedZ may contribute to B. pertussis adaptation to vaccine-induced immunity through several potential mechanisms:

• Antigenic variation: Though not a primary vaccine antigen, YedZ sequence variation across clinical isolates should be analyzed to determine if selection pressure exists. Recent genomic studies tracking the evolution of B. pertussis in response to vaccination have demonstrated adaptation mechanisms that could potentially affect YedZ .

• Metabolic reprogramming: Vaccine-induced immunity may select for strains with altered metabolic profiles, potentially involving electron transport systems in which YedZ participates. This adaptation could enhance survival under changing selective pressures.

• Stress response modulation: YedZ may contribute to enhanced stress resistance in evolved strains, helping bacteria cope with immune effectors. The spatial dynamics and evolution of B. pertussis modeled in recent studies provide context for understanding these adaptations .

• Expression regulation changes: Alterations in YedZ expression patterns might occur in response to vaccination pressure, potentially correlating with changes in virulence factor expression profiles.

• Role in transmission dynamics: As a component potentially involved in environmental sensing, YedZ might influence the transmission dynamics of B. pertussis, which have been shown to change in response to vaccination programs .

Research exploring these possibilities would benefit from integrating genomic data from clinical isolates with functional studies of YedZ, particularly comparing pre- and post-vaccination era strains.

How can YedZ research contribute to new pertussis vaccine development strategies?

YedZ research can inform new pertussis vaccine development strategies in several ways:

• Antigen evaluation: Assessment of YedZ as a potential vaccine antigen, particularly if it:

  • Shows high sequence conservation across clinical isolates

  • Is surface-exposed or secreted

  • Demonstrates immunogenicity during natural infection

  • Contributes to bacterial virulence or survival

• Subunit vaccine design: If YedZ proves to be a viable antigen, recombinant protein expression systems optimized through experimental design approaches could facilitate its production for subunit vaccines .

• Attenuated strain development: Understanding YedZ's role in bacterial metabolism and virulence could inform rational attenuation strategies for live vaccine development, targeting pathways involving YedZ.

• Adjuvant development: Insights into how YedZ and similar bacterial components interact with the immune system might inform adjuvant design for pertussis vaccines.

• Vaccine efficacy evaluation: Knowledge of YedZ's potential role in vaccine adaptation could improve the design of efficacy studies and better predict long-term vaccine performance.

This research direction aligns with efforts to develop improved pertussis vaccines in response to disease resurgence in several regions despite vaccination programs , potentially contributing to more effective prevention strategies against whooping cough.

What are the optimal storage conditions for maintaining YedZ stability?

Based on available data, the optimal storage conditions for maintaining YedZ stability include:

• Buffer composition: A Tris-based buffer supplemented with 50% glycerol, optimized specifically for this protein, provides the best stability profile .

• Temperature considerations:

  • Store at -20°C for routine use

  • For extended storage, conserve at -20°C or -80°C

  • Working aliquots can be maintained at 4°C for up to one week

• Freeze-thaw management: Repeated freezing and thawing should be avoided as it can lead to protein denaturation and activity loss . Creating single-use aliquots is strongly recommended.

• Protective additives:

  • Glycerol (50%) serves as a cryoprotectant

  • Reducing agents may be necessary to prevent oxidative damage to the heme cofactor

  • Protease inhibitors can prevent degradation during storage

• Container considerations: Low-protein binding tubes minimize adsorptive losses during storage.

• Quality control: Regular functional assays should be performed to confirm retained activity after storage periods.

These optimized storage conditions ensure maximum retention of YedZ structure and function for reliable experimental results.

How can researchers troubleshoot common issues in YedZ expression and purification?

Researchers can systematically troubleshoot common issues in YedZ expression and purification using the following approach:

Table 3: Troubleshooting Guide for YedZ Expression and Purification

Implementing the experimental design approach described in search result can systematically identify optimal conditions to overcome these challenges, significantly improving the yield and quality of recombinant YedZ.

What analytical techniques are most informative for characterizing YedZ structure and function?

A comprehensive characterization of YedZ structure and function requires multiple complementary analytical techniques:

• Spectroscopic methods:

  • UV-visible spectroscopy: Provides information on heme coordination state and oxidation status

  • Circular dichroism: Assesses secondary structure content and thermal stability

  • Fluorescence spectroscopy: Probes tertiary structure and ligand binding

  • EPR spectroscopy: Characterizes the electronic structure of the heme center

• Structural analysis:

  • X-ray crystallography (challenging for membrane proteins)

  • Cryo-electron microscopy

  • Small-angle X-ray scattering (SAXS)

  • NMR for dynamic regions or isolated domains

• Functional assays:

  • Enzyme kinetics (substrate oxidation/reduction rates)

  • Redox potential determination (cyclic voltammetry)

  • Electron transfer measurements

  • Ligand binding assays

• Interaction studies:

  • Surface plasmon resonance

  • Isothermal titration calorimetry

  • Pull-down assays

  • Crosslinking coupled with mass spectrometry

• Mass spectrometry applications:

  • Accurate mass determination

  • Post-translational modification analysis

  • Hydrogen-deuterium exchange for conformational dynamics

  • Native MS for complex integrity

• Membrane integration analysis:

  • Detergent micelle or nanodisc reconstitution

  • Lipid binding assays

  • Proteoliposome activity assays

These analytical techniques provide complementary information, allowing for a comprehensive characterization of YedZ structure, dynamics, function, and interactions within the bacterial membrane environment.