Recombinant Bordetella pertussis Type IV secretion system protein ptlD (ptlD)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant PtlD is a full-length, His-tagged version of the native PtlD protein (UniProt ID: Q7VSX8) expressed in E. coli. It corresponds to amino acids 25–463 of the mature protein and is essential for stabilizing the Ptl transporter, a type IV secretion system (T4SS) in B. pertussis .

Key Features :

PropertyDescription
SourceBordetella pertussis
Expression HostEscherichia coli
TagN-terminal His tag
Protein Length439 amino acids (25–463)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer, pH 8.0, with 6% trehalose

Role in the Ptl Transporter

PtlD is one of nine Ptl proteins (PtlA–PtlI) forming the T4SS that secretes pertussis toxin . It stabilizes the transporter by maintaining the integrity of PtlE, PtlF, and PtlH .

Critical Domains

  • C-terminal region (aa 392–463): Necessary for stabilizing PtlE, PtlF, and PtlH but insufficient for toxin secretion .

  • Core functional motif (aa 425–434): A 10-amino-acid stretch critical for transporter stability .

Stabilization Mechanism

PtlD acts as a scaffold for the transporter complex. Deletion of its C-terminal 72 amino acids destabilizes PtlE, PtlF, and PtlH, impairing PT secretion .

Assembly Model

  1. PT subunits traverse the inner membrane via the Sec system and assemble in the periplasm .

  2. A Ptl subassembly (PtlD, PtlE, PtlF, PtlG) forms in the periplasm .

  3. ATP-bound PtlH binds the complex, enabling full transporter assembly and PT secretion .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for additional charges.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ptlD; BP3791; Type IV secretion system protein PtlD; Pertussis toxin liberation protein D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-463
Protein Length
Full Length of Mature Protein
Species
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Target Names
ptlD
Target Protein Sequence
SVDDPTRAGGDNRVRALRADQARRDVLLTACRDDPGHRRGEPDCVNAERAQALQQWQAAA MTSVDAAFSDLAGALRNAAPRRMEAAIVRLTRQLQPLVYSMMTLLVLLTGYALLARRDRP FEWHIRHALLVAVVTSLALSPDRYLSTVVAGVQDVAGWLSGPWTAPDGAAGRGGLAQLDQ FAAQAQAWVAQLAGQAANDANPGSAVNWLLCAMIVAASAGGWLCLAASLLIVPGLIVTLL LSLGPLFLVLLLFPALQRWTNAWLGALVRALVFMALGTPAVGLLSDVLAGALPAGLPQRF ATDPLRSTMLAATLCATATLMLLTLVPLASSVNAGLRRRLWPNAAHPGLAQAHRQAAARQ YAPRPAAAAAAAGPHQAGTYAASATPAPAPARPAPSFPAHAYRQYALGGARRPPPRVRRD DRPAPAPDRRVLPRKPNLP
Uniprot No.

Target Background

Function
ptlD is a component of the type IV secretion system required for the secretion of assembled pertussis toxin (PTX) through the outer membrane of *Bordetella pertussis*.
Database Links

KEGG: bpe:BP3791

STRING: 257313.BP3791

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic function of PtlD in Bordetella pertussis?

PtlD is an essential component of the type IV secretion system (T4SS) in Bordetella pertussis that facilitates the export of pertussis toxin (PT) across the bacterial outer membrane. Research has demonstrated that PtlD plays a critical role in maintaining the structural integrity of the secretion apparatus by stabilizing other proteins in the Ptl transporter complex, particularly PtlE, PtlF, and PtlH. Without functional PtlD, pertussis toxin cannot be effectively secreted from the bacterium into the extracellular environment, significantly impacting bacterial virulence .

How does PtlD relate to other components of the Ptl transporter system?

The Ptl transporter system comprises nine different proteins (PtlA through PtlI) that work together to form a functional type IV secretion apparatus. PtlD functions as a stabilizing component for at least three other Ptl proteins: PtlE (a VirB8 homologue), PtlF (a VirB9 homologue), and PtlH (a VirB11 homologue). Experimental evidence shows that deletion of ptlD results in significant decreases in the detectable amounts of these proteins in bacterial cells. This suggests that PtlD serves as a structural scaffold that prevents the degradation of key components of the secretion machinery .

How is PtlD evolutionarily related to other bacterial secretion systems?

PtlD is a homologue of VirB6, a component found in other bacterial type IV secretion systems. Comparative studies with the VirB system reveal that deletion of virB6 similarly results in reductions of VirB8, VirB9, and VirB11 protein levels under conditions that favor protein turnover. This evolutionary relationship suggests conserved functions across different bacterial species and provides valuable insights for researchers studying the broader family of type IV secretion systems. Phylogenetic analysis of PtlD can help identify conserved functional domains and potential therapeutic targets .

What are the recommended approaches for generating in-frame ptlD deletion mutants?

Creating precise in-frame ptlD deletion mutants requires careful design of PCR primers and selection strategies. Based on published methodologies, researchers should:

  • Design PCR primers to amplify regions flanking the ptlD gene

  • Ligate these fragments to create a deletion construct

  • Insert the construct into a suitable vector (e.g., pSS1129 as used in published studies)

  • Introduce the construct into B. pertussis through conjugation

  • Select for homologous recombination events using appropriate antibiotics

  • Verify deletion by PCR and sequencing

This approach ensures clean deletion of ptlD while maintaining the reading frame, allowing for precise functional studies without polar effects on downstream genes .

What methods are most effective for detecting and quantifying PtlD and interacting proteins?

For optimal detection and quantification of PtlD and its interacting partners:

  • Generate specific antibodies against purified recombinant PtlD protein

  • Use immunoblotting (Western blot) for protein detection

  • Apply densitometric analysis of replicate immunoblots from independent experiments for quantification

  • Employ statistical methods such as Tukey's honestly significant difference test following analysis of variance to determine significance

  • Consider co-immunoprecipitation to study direct protein-protein interactions

  • For enhanced sensitivity, complement immunodetection with mass spectrometry-based proteomics

These approaches allow for reliable assessment of protein stability and interactions in both wild-type and mutant strains .

How can researchers effectively express and purify recombinant PtlD for structural studies?

For successful expression and purification of recombinant PtlD:

  • Clone the ptlD gene or specific domains into expression vectors with appropriate tags (His6, GST, or MBP tags can improve solubility)

  • Express in E. coli systems optimized for membrane proteins (e.g., C41(DE3) or C43(DE3) strains)

  • Use mild detergents for solubilization (DDM, LDAO, or OG depending on downstream applications)

  • Purify using affinity chromatography followed by size-exclusion chromatography

  • Verify protein quality by SDS-PAGE and Western blotting

  • Assess protein folding using circular dichroism spectroscopy

  • For difficult-to-express constructs, consider cell-free expression systems or expression in alternative hosts

Remember that as a membrane-associated protein, PtlD can present challenges for recombinant expression and may require optimization of conditions to maintain native conformation.

How do specific domains of PtlD contribute to protein-protein interactions within the Ptl complex?

The C-terminal region of PtlD (amino acids 392-463) is sufficient for maintaining the stability of interacting Ptl proteins, indicating this domain is crucial for protein-protein interactions. Research has further demonstrated that a specific 10-amino acid stretch (amino acids 425-434) makes significant contributions to this stabilizing function. To investigate domain-specific interactions:

  • Generate truncated versions of PtlD with progressive deletions

  • Express these constructs in ptlD deletion strains

  • Assess the stability of PtlE, PtlF, and PtlH by immunoblotting

  • Use bacterial two-hybrid systems to detect direct protein interactions

  • Apply cross-linking followed by mass spectrometry to map interaction interfaces

  • Perform mutagenesis of conserved residues within the C-terminal domain to identify critical amino acids

These approaches can help create a detailed map of interaction interfaces and guide structural biology efforts .

What methodologies can unravel the temporal assembly of the Ptl transporter complex?

Understanding the assembly pathway of the Ptl transporter requires sophisticated approaches:

  • Develop inducible expression systems for individual Ptl components

  • Establish pulse-chase experiments with immunoprecipitation to track protein assembly

  • Apply time-resolved crosslinking to capture assembly intermediates

  • Use fluorescently tagged Ptl proteins with FRET analysis to monitor real-time interactions

  • Employ single-particle cryo-EM to visualize assembly intermediates

  • Utilize hydrogen-deuterium exchange mass spectrometry to identify dynamic interaction regions

  • Develop quantitative proteomics approaches to measure stoichiometry during assembly

These methods can reveal the sequence of events in Ptl complex formation and identify rate-limiting steps that might serve as intervention points.

How does PtlD contribute to the energetics of pertussis toxin secretion?

Investigating the energetic contributions of PtlD requires:

  • Design ATP hydrolysis assays to measure energy consumption in wild-type versus ptlD mutant strains

  • Create point mutations in potential energy-coupling domains

  • Perform isothermal titration calorimetry to measure binding energetics between PtlD and other components

  • Develop real-time secretion assays using fluorescently labeled pertussis toxin

  • Measure proton motive force utilization in secretion-competent versus incompetent strains

  • Apply computational modeling to predict energy transfer pathways through the Ptl complex

Understanding these energetic contributions could reveal how the system converts chemical energy into mechanical work for toxin translocation.

What approaches can distinguish between PtlD's stabilizing function and its direct role in toxin secretion?

To differentiate between these functions:

  • Create chimeric proteins where the C-terminal stabilizing domain (amino acids 392-463) is fused to heterologous membrane anchors

  • Assess whether these constructs restore PtlE, PtlF, and PtlH stability without supporting toxin secretion

  • Develop in vitro reconstitution systems with purified components to test direct interactions with toxin subunits

  • Apply site-specific crosslinking to detect transient interactions between PtlD and toxin during secretion

  • Use electron microscopy to visualize structural changes in the secretion apparatus with wild-type versus truncated PtlD

These experiments can help determine whether PtlD plays additional roles beyond stabilizing other Ptl proteins .

How can researchers map the membrane topology of PtlD to understand its integration into the secretion apparatus?

For accurate membrane topology mapping:

  • Generate reporter fusions (PhoA/LacZ) at various positions within PtlD

  • Apply site-specific labeling with membrane-impermeant reagents

  • Use protease accessibility assays in spheroplasts versus intact cells

  • Perform cryo-electron tomography on bacterial membranes containing the Ptl complex

  • Apply molecular dynamics simulations to predict stable membrane-embedded conformations

  • Use EPR spectroscopy with spin-labeled cysteines to determine accessibility in lipid environments

Topology information is crucial for understanding how PtlD interacts with both the membrane and other Ptl components.

What experimental designs can elucidate the potential role of PtlD in substrate recognition during toxin secretion?

To investigate substrate recognition functions:

  • Perform co-purification experiments between PtlD and pertussis toxin subunits

  • Create chimeric toxins with altered potential recognition motifs

  • Develop in vitro binding assays using surface plasmon resonance or microscale thermophoresis

  • Conduct targeted mutagenesis of conserved residues in potential substrate-binding regions

  • Apply photo-crosslinking with unnatural amino acids to capture transient interactions

  • Use computational docking to predict potential interaction interfaces

  • Perform deep mutational scanning of both PtlD and toxin subunits to identify critical interaction residues

These approaches can reveal whether PtlD directly participates in substrate recognition or primarily serves a structural role.

How do mutations in the C-terminal domain of PtlD affect virulence in animal models of pertussis?

To assess the impact of PtlD mutations on virulence:

  • Generate B. pertussis strains with targeted mutations in the C-terminal domain (especially amino acids 425-434)

  • Measure toxin secretion levels in vitro using ELISA or functional assays

  • Assess bacterial colonization in respiratory infection models

  • Quantify immune responses to infection with mutant versus wild-type strains

  • Evaluate histopathological changes in respiratory tissues

  • Perform competitive infection experiments between wild-type and mutant strains

  • Correlate specific mutations with changes in disease severity and duration

This research direction provides valuable insights into structure-function relationships with direct relevance to pathogenesis .

What methodological approaches can identify inhibitors of PtlD function as potential therapeutic agents?

For inhibitor discovery and development:

  • Establish high-throughput screening assays for PtlD stabilizing function

  • Develop fluorescence-based real-time assays for toxin secretion

  • Design fragment-based screens targeting the critical C-terminal domain

  • Apply structure-based virtual screening if structural data becomes available

  • Assess peptide mimetics of the essential 10-amino acid region (425-434)

  • Evaluate natural product libraries for compounds that destabilize the Ptl complex

  • Develop cell-based assays to identify inhibitors with appropriate permeability

This research has translational potential for developing novel therapeutic approaches against pertussis.

How does the function of PtlD compare with homologous proteins in other bacterial type IV secretion systems?

For comparative analysis:

  • Perform multiple sequence alignment of PtlD with VirB6 homologues from diverse bacteria

  • Generate phylogenetic trees to map evolutionary relationships

  • Identify conserved versus variable regions that might indicate functional specialization

  • Conduct complementation experiments by expressing heterologous VirB6-like proteins in ptlD deletion strains

  • Develop chimeric proteins swapping domains between PtlD and other VirB6 homologues

  • Compare protein-protein interaction networks across different T4SS systems

  • Use structural prediction algorithms to identify potential functional convergence despite sequence divergence

This comparative approach places PtlD research in a broader context of bacterial secretion system evolution and function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.