Recombinant Bordetella pertussis Type IV secretion system protein ptlE (ptlE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ptlE; BP3793; Type IV secretion system protein PtlE; Pertussis toxin liberation protein E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Target Names
ptlE
Target Protein Sequence
MPDPRPLTPDQTHGRGHAEAAVDWEASRLYRLAQSERRAWTVAWAALAVTALSLIAIATM LPLKTTIPYLIEVEKSSGAASVVTQFEPRDFTPDTLMNQYWLTRYVAARERYDWHTIQHD YDYVRLLSAPAVRHDYETSYEAPDAPDRKYGAGTTLAVKILSAIDHGKGVGTVRFVRTRR DADGQGAAESSIWVATVAFAYDQPRALTQAQRWLNPLGFAVTSYRVDAEAGQP
Uniprot No.

Target Background

Function
A component of the type IV secretion system ptl, essential for the secretion of assembled pertussis toxin (PTX) across the outer membrane. It may possess peptidoglycanase activity.
Database Links

KEGG: bpe:BP3793

STRING: 257313.BP3793

Protein Families
VirB8 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is PtlE and what is its primary function in Bordetella pertussis?

PtlE is a protein component of the pertussis toxin liberation (Ptl) system in Bordetella pertussis, the bacterium responsible for causing whooping cough. This protein exhibits peptidoglycanase activity, which means it has the ability to break down or modify peptidoglycan, a key structural component of bacterial cell walls . The primary function of PtlE within B. pertussis is to facilitate the secretion of pertussis toxin by locally removing or rearranging the peptidoglycan layer, which would otherwise act as a barrier to the movement of large protein complexes through the bacterial cell envelope . This enzymatic activity is essential for the proper assembly and function of the Ptl secretion system, which spans both the inner and outer membranes of the bacterium. Without PtlE's peptidoglycanase activity, the pertussis toxin would be unable to traverse the cell wall effectively, resulting in deficient toxin secretion and potentially reduced bacterial virulence.

How does PtlE fit into the broader Type IV secretion system architecture?

PtlE functions as an integral component of the Type IV secretion system (T4SS) in Bordetella pertussis, which is comprised of the products of at least nine ptl genes (ptlA through ptlI) . Within this complex molecular machine, PtlE occupies a position that allows it to interact with both the peptidoglycan layer and other components of the secretion apparatus. Unlike some T4SS such as the Cag T4SS of Helicobacter pylori which features a 14-fold symmetric outer membrane core complex and a 17-fold symmetric periplasmic ring complex , the structural symmetry and precise architectural details of the Ptl system remain less well characterized. The Ptl system spans both the inner and outer membranes of B. pertussis, creating a continuous channel for pertussis toxin translocation through the bacterial cell envelope. PtlE's strategic position within this complex enables it to perform its peptidoglycanase function at the precise locations where the secretion apparatus must traverse the peptidoglycan layer. Additionally, evidence suggests that PtlE's functional expression may be interconnected with other Ptl proteins, particularly PtlF, as mutations in ptlI (which encodes a small protein located between ptlD and ptlE) affect the expression of both PtlE and PtlF .

What is the active site structure of PtlE and how does it relate to its peptidoglycanase activity?

The peptidoglycanase activity of PtlE is directly tied to its active site structure, which shares sequence homology with glycohydrolase enzymes . Critical residues within the PtlE active site include an aspartic acid at position 53 and a glutamic acid at position 62, both of which are essential for the protein's enzymatic function . These amino acids likely participate in the catalytic mechanism through which PtlE cleaves or modifies the peptidoglycan structure. This functional arrangement is consistent with other peptidoglycanases, where acidic residues often play key roles in the hydrolysis reaction. When these critical residues are substituted with alanine through site-directed mutagenesis, the resulting mutant PtlE protein loses its peptidoglycanase activity, as demonstrated in activity gel assays . The functional importance of these residues extends beyond in vitro enzymatic activity, as B. pertussis strains expressing PtlE with alanine substitutions at positions 53 and 62 show significant deficiency in pertussis toxin secretion . This direct structure-function relationship provides crucial insight into how the molecular architecture of PtlE enables its biological role in facilitating toxin transport across the bacterial cell envelope.

What are the optimal methods for recombinant expression and purification of PtlE?

Successful recombinant expression of PtlE requires careful optimization of experimental conditions, as this protein has specific structural requirements for maintaining its peptidoglycanase activity. One effective approach involves creating an N-terminally polyhistidine-tagged PtlE fusion protein, which can be expressed in both Escherichia coli and B. pertussis expression systems . When designing expression vectors, researchers should consider that the ptlE gene boundaries may differ from initial predictions, as evidenced by research on the related ptlI gene . For purification, immobilized metal affinity chromatography (IMAC) leveraging the polyhistidine tag offers an efficient initial capture step. The design of experiments (DoE) methodology can significantly enhance optimization of expression and purification parameters, allowing researchers to systematically evaluate multiple factors simultaneously rather than using the less efficient one-factor-at-a-time approach . Through DoE, researchers can identify optimal conditions for temperature, induction time, inducer concentration, and buffer compositions with a reduced number of experiments. This methodological approach is particularly valuable for PtlE, as maintaining its native conformation and enzymatic activity requires balancing multiple interacting factors during the recombinant production process.

How can researchers effectively assess the peptidoglycanase activity of PtlE?

Assessing the peptidoglycanase activity of PtlE requires specialized techniques that can detect enzymatic modification of peptidoglycan substrates. One validated approach involves activity gel assays, where the protein is separated by electrophoresis in gels containing peptidoglycan substrate, followed by incubation and staining to visualize zones of peptidoglycan hydrolysis . For quantitative analysis, researchers can employ spectrophotometric assays that measure the release of soluble peptidoglycan fragments or reduction in turbidity of peptidoglycan suspensions over time. When evaluating activity, it is essential to include appropriate positive and negative controls, such as PtlE variants with alanine substitutions at the critical active site residues (D53A and E62A), which demonstrate abolished peptidoglycanase activity . Complementary approaches may include mass spectrometry analysis of reaction products to characterize the specific peptidoglycan bonds cleaved by PtlE. Researchers should also consider evaluating PtlE activity under various pH and ionic strength conditions to determine optimal reaction parameters, which can be systematically assessed using design of experiments (DoE) methodologies to efficiently explore the multidimensional parameter space .

What structural biology techniques are most useful for studying PtlE and the Type IV secretion system?

Advanced structural biology techniques provide crucial insights into PtlE's conformation and its integration within the Type IV secretion system. Cryo-electron microscopy (cryo-EM) represents a particularly valuable approach, as demonstrated by its successful application to the H. pylori Cag T4SS, revealing unprecedented details of T4SS architecture . For PtlE structural studies, researchers should consider a multi-tiered approach beginning with protein crystallography to resolve the atomic structure of the isolated protein, particularly focusing on the active site containing the critical D53 and E62 residues . Single-particle cryo-EM can then be employed to visualize the intact Ptl secretion apparatus, using methods similar to those described for the H. pylori T4SS, where samples were applied to ultrathin carbon film grids, vitrified by plunge-freezing, and imaged using a Titan Krios electron microscope equipped with a K2 Summit Direct Electron Detector . Complementary techniques include small-angle X-ray scattering (SAXS) for solution-state structural information and hydrogen-deuterium exchange mass spectrometry to map protein-protein interaction surfaces between PtlE and other Ptl components. For optimal cryo-EM sample preparation of the assembled Ptl complex, researchers should consider using deoxycholate at reduced concentrations (0.025%) during purification, as this approach has proven effective for preserving T4SS structural integrity .

How does PtlE's function compare to similar components in other bacterial Type IV secretion systems?

PtlE represents a specialized component within the Bordetella pertussis Type IV secretion system (T4SS), and its functional role can be contextualized through comparison with other bacterial T4SSs. While the Cag T4SS of Helicobacter pylori and other canonical T4SSs share the fundamental purpose of translocating macromolecules across bacterial membranes, the Ptl system demonstrates several distinctive features . Unlike the Cag T4SS, which translocates the CagA oncoprotein into gastric cells and contributes to gastric cancer pathogenesis, the Ptl system specifically secretes pertussis toxin, a key virulence factor in whooping cough pathology . The structural organization also differs significantly, with the H. pylori Cag T4SS featuring a 14-fold symmetric outer membrane core complex and a 17-fold symmetric periplasmic ring complex—a symmetry mismatch not yet confirmed in the Ptl system . PtlE's peptidoglycanase function appears to be adapted to the specific requirements of pertussis toxin secretion, facilitating the passage of this large protein complex through the peptidoglycan layer . This specialized enzymatic activity highlights how bacterial T4SSs have evolved distinct mechanisms to overcome the peptidoglycan barrier, resulting in remarkable structural diversity among these secretion systems across different bacterial species.

What is the relationship between PtlE and other Ptl proteins in the secretion complex?

The functional integration of PtlE within the Ptl secretion complex involves intricate relationships with other Ptl proteins. Research indicates that the Ptl system comprises at least nine proteins (PtlA through PtlI) that collectively form a multicomponent secretion apparatus spanning both the inner and outer membranes of Bordetella pertussis . PtlE's expression and function appear to be interconnected with neighboring genes in the ptl locus, particularly ptlI, which encodes a small protein of approximately 5,200 Da located between ptlD and ptlE . Experimental evidence shows that mutations in ptlI affect the expression of both PtlE and PtlF, suggesting a potential regulatory or stabilizing role for PtlI in the expression of these proteins . Additionally, the proper assembly of the secretion complex likely requires coordinated expression and interaction of all Ptl components, as mutations affecting individual proteins can disrupt the functionality of the entire complex. The peptidoglycanase activity of PtlE presumably facilitates the assembly of the secretion apparatus by creating localized modifications in the peptidoglycan layer, allowing large protein components like PtlC through PtlH to traverse this otherwise impermeable barrier . This cooperative integration of PtlE within the secretion machinery exemplifies the sophisticated molecular architecture that enables pertussis toxin secretion.

What are the potential applications of recombinant PtlE in vaccine development or therapeutic contexts?

The peptidoglycanase activity of recombinant PtlE presents intriguing possibilities for vaccine development and therapeutic applications against Bordetella pertussis infections. As a critical component enabling pertussis toxin secretion, PtlE represents a potential target for attenuating bacterial virulence without directly targeting the toxin itself . Recombinant PtlE could be utilized in subunit vaccine formulations, potentially eliciting antibodies that interfere with toxin secretion when the pathogen encounters the immunized host. Furthermore, the unique active site of PtlE, with its critical aspartic acid at position 53 and glutamic acid at position 62, offers a distinct target for structure-based drug design of specific inhibitors . Development of such therapeutics would require sophisticated recombinant protein production methodologies, optimized through design of experiments (DoE) approaches to ensure consistent yield and activity of the target protein . When exploring these applications, researchers must systematically assess multiple experimental parameters including expression systems, purification protocols, and formulation conditions to maintain the native conformation and immunogenicity of PtlE. Additionally, any therapeutic development would necessitate comprehensive analysis of potential cross-reactivity with human proteins and careful evaluation of immunological responses to ensure safety and efficacy.

How might computational approaches enhance our understanding of PtlE structure and function?

Computational approaches offer powerful tools for elucidating the molecular details of PtlE structure and function beyond what experimental techniques alone can achieve. Homology modeling can generate preliminary structural models of PtlE based on related peptidoglycanases and glycohydrolases, providing insights into the spatial arrangement of the active site residues D53 and E62 . Molecular dynamics simulations can then explore the conformational flexibility of PtlE and its interactions with peptidoglycan substrates, potentially revealing the catalytic mechanism and substrate specificity determinants. Machine learning algorithms, particularly those utilizing natural language processing of the scientific literature, could identify patterns and relationships in experimental data that might otherwise remain obscure . For systems-level analysis, knowledge graph approaches can integrate diverse experimental findings about PtlE and the Ptl system, though researchers must be vigilant about potential inconsistencies in the aggregated data . These computational methods become especially valuable when applied to the complex multiprotein Ptl secretion apparatus, where experimental structural determination faces significant challenges. By combining computational predictions with targeted experimental validation, researchers can develop more comprehensive models of how PtlE contributes to the assembly and function of the pertussis toxin secretion system, potentially guiding the design of more effective intervention strategies against B. pertussis infections.

What is the evolutionary significance of PtlE in the context of bacterial secretion systems?

The evolutionary trajectory of PtlE offers valuable insights into the diversification and specialization of bacterial secretion systems. Type IV secretion systems (T4SSs) represent ancient macromolecular assemblies that have evolved to fulfill diverse functions across bacterial species, from DNA transfer during conjugation to protein translocation during host cell infection . Within this broader evolutionary context, the Ptl system of Bordetella pertussis represents a specialized adaptation for the specific purpose of secreting pertussis toxin . The peptidoglycanase activity of PtlE likely evolved as a solution to the fundamental challenge of transporting large protein complexes across the peptidoglycan barrier, which acts as a rigid mesh surrounding the bacterial cell. Comparative genomic analyses could reveal whether PtlE homologs exist in related secretion systems and how their sequences and functions have diverged over evolutionary time. The notable structural differences between the Ptl system and other T4SSs, such as the Cag system of Helicobacter pylori with its distinctive symmetry patterns, highlight the remarkable evolutionary plasticity of these secretion machineries . Furthermore, the apparent co-evolution of PtlE with neighboring components like PtlI suggests that the entire ptl locus evolved as an integrated functional unit . Understanding these evolutionary relationships could provide broader insights into how bacterial pathogens have adapted their molecular machinery to overcome host defenses and establish successful infections.

How can researchers effectively investigate PtlE-peptidoglycan interactions?

Investigating the specific interactions between PtlE and its peptidoglycan substrate requires a multifaceted approach combining biochemical, biophysical, and computational techniques. Researchers should first consider the complexity and heterogeneity of peptidoglycan structures, which can vary in cross-linking, sugar modifications, and peptide composition depending on bacterial species and growth conditions. Purified peptidoglycan sacculi from B. pertussis represent the most physiologically relevant substrate, though commercially available peptidoglycan from related species may serve as suitable alternatives for initial studies. Binding assays using labeled peptidoglycan fragments can determine affinity constants and binding kinetics, while catalytic assays with defined substrates can elucidate bond specificity of PtlE's peptidoglycanase activity. Mass spectrometry analysis of reaction products provides detailed information about the precise chemical bonds cleaved by PtlE . Microscopy techniques, including atomic force microscopy of peptidoglycan sacculi before and after PtlE treatment, can visualize structural changes at the nanoscale. For mechanistic insights, hydrogen-deuterium exchange mass spectrometry can map conformational changes in PtlE upon substrate binding. Site-directed mutagenesis of residues beyond the established D53 and E62 active site positions can identify additional amino acids involved in substrate recognition or catalysis . Through systematic application of these complementary approaches, researchers can develop a comprehensive model of how PtlE recognizes, binds, and modifies peptidoglycan to facilitate pertussis toxin secretion.

What strategies can address the challenges of studying protein-protein interactions within the Type IV secretion system?

Investigating protein-protein interactions within the complex Type IV secretion system presents significant challenges due to the membrane-associated nature of many components and the transient character of some interactions. Researchers can overcome these obstacles through a strategic combination of in vivo and in vitro approaches. In vivo crosslinking with membrane-permeable agents followed by co-immunoprecipitation can capture native interactions between PtlE and other Ptl proteins within the bacterial cell context. Bacterial two-hybrid or split-protein complementation assays offer alternatives for detecting binary interactions, though careful control experiments are essential to minimize false positives. For in vitro studies, researchers should consider systematic co-expression of multiple Ptl components, as exemplified by research showing the interdependence of PtlE, PtlF, and PtlI expression . Surface plasmon resonance and isothermal titration calorimetry can provide quantitative information about binding affinities and thermodynamics when working with purified components. Hydrogen-deuterium exchange mass spectrometry represents a powerful approach for mapping interaction interfaces with high resolution. For structural characterization of assembled complexes, cryo-electron microscopy has demonstrated significant utility for T4SS research, as evidenced by the successful structural determination of the H. pylori Cag T4SS . This technique can be adapted for the B. pertussis Ptl system, though researchers should optimize sample preparation conditions, possibly using reduced concentrations of detergents like deoxycholate (0.025%) to preserve complex integrity .

How can researchers resolve contradictory findings in PtlE research?

Addressing contradictions in experimental findings about PtlE requires systematic analysis of methodological differences and careful evaluation of experimental contexts. When confronted with apparently conflicting results, researchers should first examine methodological variations in protein expression systems, purification protocols, and assay conditions that might explain discrepancies. For instance, the exact boundaries of the ptlE gene were clarified through research on the neighboring ptlI gene, demonstrating that initial predictions about gene structure required revision . This finding illustrates how apparent contradictions can sometimes be resolved through more precise genetic analysis. When analyzing inconsistent data about PtlE function, researchers should consider whether the experimental context (in vitro versus in vivo, isolated protein versus assembled complex) might influence observed activities. Knowledge graph analysis approaches can help identify patterns of contradictions across multiple studies, though researchers must be vigilant about potential inconsistencies in the integrated data . Statistical meta-analysis methodologies can quantitatively evaluate the weight of evidence across multiple studies, accounting for variations in sample sizes and methodological rigor. In cases where contradictions persist despite thorough analysis, researchers should design crucial experiments specifically aimed at resolving the discrepancies, ideally through collaboration between groups reporting conflicting results. This approach not only addresses specific contradictions but can lead to deeper insights into the contextual factors affecting PtlE structure and function.

What statistical approaches are most appropriate for analyzing PtlE functional data?

The selection of appropriate statistical methodologies for PtlE functional studies should be guided by experimental design principles and the specific research questions being addressed. For experiments exploring multiple factors affecting PtlE activity, analysis of variance (ANOVA) provides a robust framework for assessing main effects and interactions between experimental variables. Response surface methodology, as part of the broader Design of Experiments (DoE) approach, enables researchers to model complex relationships between multiple factors and identify optimal conditions for PtlE expression or activity . When comparing wild-type and mutant PtlE variants (such as the D53A and E62A active site mutants), paired statistical tests with appropriate controls for multiple comparisons can minimize the risk of Type I errors . For kinetic studies of PtlE peptidoglycanase activity, nonlinear regression analysis using mechanistic models can extract meaningful parameters such as Km and Vmax values. Time-series data from structural studies or secretion assays may require specialized statistical approaches such as repeated measures ANOVA or mixed-effects models. Regardless of the specific statistical methodology employed, researchers should clearly report sample sizes, measures of variability, and precise p-values rather than threshold-based significance statements. Power analysis during experimental planning helps ensure sufficient sample sizes to detect biologically meaningful effects. When analyzing complex datasets from high-throughput approaches, researchers should consider consulting with statistical specialists to select appropriate methods for controlling false discovery rates while maintaining sufficient statistical power.

How can bioinformatics tools enhance the analysis of PtlE structure and function?

Bioinformatics tools offer powerful capabilities for analyzing PtlE structure and function within both evolutionary and mechanistic contexts. Sequence analysis tools can identify conserved motifs within PtlE, particularly focusing on the glycohydrolase-like active site containing the critical D53 and E62 residues . Multiple sequence alignment of PtlE homologs across Bordetella species and related bacteria can reveal conserved functional domains and species-specific variations that might reflect adaptation to different host environments. Structural prediction algorithms, including AlphaFold and RoseTTAFold, can generate high-confidence models of PtlE tertiary structure, which can then guide hypothesis formation and experimental design. Molecular docking simulations can model interactions between PtlE and peptidoglycan substrates, potentially identifying additional residues involved in substrate recognition beyond the established catalytic site. For systems-level analysis, protein-protein interaction prediction algorithms can generate testable hypotheses about how PtlE interfaces with other components of the Ptl secretion apparatus. Natural language processing approaches can extract relationship information from scientific literature, helping researchers identify connections that might not be immediately apparent through traditional literature reviews . When analyzing potential inconsistencies in integrated datasets, knowledge graph approaches can help visualize contradictions and guide further investigation . By systematically applying these complementary bioinformatics approaches, researchers can develop a more comprehensive understanding of PtlE structure and function, potentially identifying novel aspects that might not be readily apparent through experimental approaches alone.

What are the most promising avenues for future PtlE research?

Future research on PtlE should address several critical knowledge gaps while leveraging emerging technologies to gain deeper insights into this protein's structure and function. High-resolution structural determination of PtlE, both in isolation and within the assembled Type IV secretion complex, represents a particularly promising research direction. Cryo-electron microscopy approaches similar to those used for the H. pylori Cag T4SS could reveal unprecedented details of how PtlE integrates into the secretion apparatus . Mechanistic studies exploring the precise catalytic mechanism of PtlE's peptidoglycanase activity would benefit from time-resolved spectroscopy or crystallography capturing different states of the enzyme-substrate complex. Investigation of potential regulatory mechanisms controlling PtlE activity within the bacterial cell could reveal how peptidoglycan modification is coordinated with secretion complex assembly. The interdependence between PtlE and other Ptl proteins, particularly PtlF and PtlI, warrants detailed exploration through both genetic and biochemical approaches . Development of specific inhibitors targeting PtlE's peptidoglycanase activity could yield valuable research tools and potential therapeutic leads. Advanced imaging techniques, such as super-resolution microscopy or correlative light and electron microscopy, could visualize the dynamics of secretion complex assembly and PtlE localization within bacterial cells. Implementation of CRISPR-based approaches for precise genome editing in B. pertussis would facilitate more sophisticated genetic analysis of PtlE function in its native context. By pursuing these complementary research directions, investigators can develop a more comprehensive understanding of how PtlE contributes to pertussis toxin secretion and bacterial pathogenesis.

How might emerging technologies advance our understanding of PtlE?

Emerging technologies across multiple scientific disciplines offer exciting opportunities to advance our understanding of PtlE structure, function, and role in bacterial pathogenesis. Single-particle cryo-electron microscopy, which has already transformed structural biology of large macromolecular assemblies like the H. pylori T4SS, could be applied to visualize the B. pertussis Ptl system at unprecedented resolution . Time-resolved cryo-EM might capture different conformational states during the secretion process. Integrative structural biology approaches combining cryo-EM with cross-linking mass spectrometry could map the complex network of interactions between PtlE and other Ptl components. Microfluidic systems for high-throughput protein crystallization and serial crystallography at X-ray free-electron lasers could facilitate structural studies of challenging targets like membrane-associated secretion complexes. For functional studies, advances in genome editing technologies, particularly CRISPR-Cas systems optimized for bacterial applications, could enable more precise genetic manipulation of the ptl locus. Single-molecule techniques, including Förster resonance energy transfer (FRET) and atomic force microscopy, could provide insights into the dynamics of PtlE-substrate interactions and conformational changes during catalysis. Artificial intelligence approaches, particularly deep learning for image analysis and natural language processing for literature mining, could accelerate discovery by identifying patterns in complex datasets . By strategically incorporating these emerging technologies into research programs, investigators can overcome longstanding technical barriers and develop more comprehensive models of how PtlE contributes to pertussis toxin secretion and bacterial virulence.

What interdisciplinary approaches might yield new insights into PtlE function?

Interdisciplinary collaboration represents a particularly promising strategy for advancing PtlE research beyond the limitations of traditional disciplinary boundaries. Integration of structural biology with computational biology could yield more comprehensive models of PtlE function, combining experimental structural data with molecular dynamics simulations to understand the protein's conformational dynamics during substrate binding and catalysis. Collaboration between microbiologists and immunologists could elucidate how PtlE-mediated pertussis toxin secretion influences host-pathogen interactions and immune responses during B. pertussis infection. Systems biology approaches could place PtlE function within broader regulatory networks controlling virulence factor expression and secretion in response to environmental cues. Bioengineering perspectives could explore potential applications of PtlE's peptidoglycanase activity in creating novel delivery systems for therapeutic proteins across bacterial cell walls. Chemical biology approaches, including activity-based protein profiling with customized probes targeting peptidoglycanases, could provide new tools for studying PtlE activity in complex biological contexts. Implementation of Design of Experiments (DoE) methodologies from the field of statistical experimental design could enhance efficiency and reproducibility across multiple experimental approaches . Integration of knowledge representation frameworks from computer science, such as those used to analyze inconsistencies in knowledge graphs, could help synthesize and evaluate potentially contradictory findings from diverse experimental approaches . By fostering communication and collaboration across these disciplinary boundaries, researchers can develop more holistic understanding of PtlE's roles in bacterial physiology and pathogenesis.

What are the key technical challenges in working with recombinant PtlE?

Researchers working with recombinant PtlE face several technical challenges that require careful consideration and methodological refinement. Expression of functional PtlE presents a significant challenge, as this protein contains a catalytic domain that may be toxic to expression hosts if it hydrolyzes their peptidoglycan layer. Strategies to address this include using tightly regulated inducible promoters, expression as fusion proteins with solubility-enhancing partners, or employing cell-free expression systems. The proper folding of PtlE may depend on specific chaperones or redox conditions not readily replicated in heterologous expression systems. Researchers have successfully expressed PtlE with an N-terminal polyhistidine tag in both E. coli and B. pertussis, though the specific conditions required for optimal expression likely differ between these systems . Purification of PtlE presents additional challenges, as the protein may interact with peptidoglycan fragments during cell lysis, potentially affecting solubility and purification efficiency. Maintaining enzymatic activity throughout purification requires careful optimization of buffer conditions and purification strategies. The Design of Experiments (DoE) approach offers a systematic framework for addressing these challenges by efficiently exploring multiple parameters simultaneously . When assessing PtlE activity, researchers must consider that the natural substrate—the intact peptidoglycan layer in its native context—is difficult to replicate in vitro. Development of physiologically relevant activity assays therefore requires careful consideration of substrate preparation and detection methods. By systematically addressing these technical challenges through methodological optimization and innovation, researchers can enhance the reliability and reproducibility of PtlE studies.

How can researchers ensure reproducibility in PtlE functional studies?

Ensuring reproducibility in PtlE functional studies requires meticulous attention to methodological details and implementation of robust experimental design principles. Researchers should develop standardized protocols for PtlE expression, purification, and activity assays, with comprehensive documentation of all experimental parameters including expression strain genotypes, media compositions, induction conditions, and buffer formulations. The Design of Experiments (DoE) methodology provides a systematic framework for exploring and optimizing multiple experimental parameters while minimizing the number of experiments required . This approach can help identify robust conditions where PtlE activity remains stable despite minor variations in experimental parameters. Researchers should implement appropriate quality control measures at each experimental stage, including verification of protein identity by mass spectrometry, assessment of purity by multiple methods, and confirmation of structural integrity through circular dichroism or thermal shift assays. When conducting activity assays, inclusion of appropriate positive and negative controls is essential, such as the catalytically inactive D53A/E62A PtlE variant as a negative control . Statistical considerations should be addressed during experimental planning, including power analysis to determine appropriate sample sizes and randomization strategies to minimize systematic errors. Sharing of detailed protocols through repositories like protocols.io and deposition of raw data in appropriate databases enhances transparency and facilitates reproduction by other research groups. By implementing these comprehensive reproducibility measures, researchers can strengthen the reliability of findings about PtlE function and accelerate scientific progress in this field.

What safety considerations are important when working with components of the pertussis toxin secretion system?

Research involving components of the pertussis toxin secretion system necessitates careful attention to biosafety considerations to protect researchers and prevent inadvertent release of potentially hazardous materials. While recombinant PtlE itself is unlikely to pose significant hazards when expressed in isolation from other pertussis toxin components, researchers should nonetheless adhere to appropriate biosafety practices for working with recombinant proteins from pathogenic organisms. Work with intact Bordetella pertussis, particularly virulent strains, requires biosafety level 2 (BSL-2) containment facilities and procedures, including use of biological safety cabinets for aerosol-generating procedures and appropriate personal protective equipment. When cloning and expressing ptl genes, researchers should consider potential risks associated with creating novel functional combinations of secretion system components in laboratory strains. If conducting research involving both PtlE and pertussis toxin components, additional precautions may be warranted, as reconstitution of a functional secretion system could theoretically enable toxin secretion. Decontamination procedures should be validated for effectiveness against B. pertussis, with particular attention to proper disposal of materials potentially containing viable bacteria. Institutional biosafety committee review and approval should be obtained before initiating research involving pertussis toxin secretion system components. Researchers should maintain awareness of dual-use research of concern implications, particularly for studies aimed at modifying or enhancing secretion system function. By maintaining vigilant adherence to these safety considerations, researchers can pursue important scientific questions about PtlE and the pertussis toxin secretion system while minimizing risks to laboratory personnel and the broader community.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.